CAZyme Information: CNAG_02694-t26_2-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_02694-t26_2-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		62434.98	4.9878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003822.1:999645-1001493(-)

Full Sequence      

MHIVYILGLAPLAFAAVIERDPPKFQPVQSTKTVRLHPNGDKSKCVDLLGNDHQDGQPVQ
VYDCNGTPAQDWVLNAGRGQTKVQLAGTNFCLDATHPYAADGIKMKIWKCLDVRQQDWYW
TSDNKIALRDQGKCLDWANGDRSDFNQLQVWQCSTGNNNQVWTTGPDYGGKHGDNTGGNH
GDNTGGNHGDNTGGNHGGNTGGNPGGNQGGDSGGKTNQIIPDPPGPDPNSESLNPALEAI
VNVTEAAGPWPPMISFDGDYSNDDLTVSDQVPFDYCIGEGSGNLTDDEGQQQGQNFTANV
AGIGRDFCLDNFGNPDIRNTTSFDNNTSTGNEANIGRALHKRTFADSGATGTPNRWRRGS
VISICVERNNDYLVPYASSPVPIRASAIVASAMVRAINFWNAGLNKQFVSFEFVENCNDA
VFHTLAVDRTKSAREPNVLATAPFPPRGVAGARNRDIFVYNTAFQSNFQNVLTFIMSHEL
GHTLGLAHEDCKSTDQPCEVITDKVAGSVVESHISGSTTELFEGPTLLDIAGANKYYSLA
TGPNTLEKIVLWPATRGPFISYPPLPRCKWFLGICYY

Enzyme Prediction     

No EC number prediction in CNAG_02694-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	32	163	1.3e-19	0.675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.89e-19	33	162	2	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.47e-18	34	164	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411518	lectin_1	1.36e-14	41	164	719	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411519	lectin_2	5.06e-12	40	162	124	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
214672	RICIN	6.28e-12	39	164	3	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV14186.1|CBM13	0.0	1	577	1	577
AUB23598.1|CBM13	0.0	1	577	1	577
AFR93997.1|CBM13	0.0	1	577	1	577
UOH83865.1|CBM13	0.0	1	577	1	540
AAW46144.1|CBM13	0.0	1	577	1	571

PDB Hits     

CNAG_02694-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

CNAG_02694-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999751	CS pos: 15-16. Pr: 0.9523

TMHMM  Annotations     

There is no transmembrane helices in CNAG_02694-t26_2-p1.