CAZyme Information: CNAG_02351-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNAG_02351-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: endochitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	CP003825.1|CGC4	67847.32	4.0129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansH99	8338	235443	1363	6975

• Gene Location: location=CP003825.1:542534-545056(-)

Full Sequence      

MYCTLATLSLLALAEAAGPHNRRLDDRRRHYARMALSGEYKTPPMPHNLHVEVPTKRDGC
THGDWNCVGLQLQRCNWGDWIVLQNCTGENIICSTQQDAVGCVWTWSVDDSTTSQGAQDI
PLATTSLVFDASSAVSASYASATASHGLDGHEPAGTASSYYAAATTSTTASDMDNEACDD
EDDDDDEVCEDEDEDGDGDASSSTFNAATITSSATLPTSNAQETETSQIGDGLWAGHKSE
SASSGNDWEGTAASNGNVWEGTASSDHKSRTKQWGSWKTTFASAESATTNPWDNTASATK
QYWGDASATGSASQGKDHTSVQTGANTSVSYPAATASFTNTTTTAGSSSNSASTTIGGWS
APHHVIYADRWLSAMPDVSELDSFNRFILAFWESSGGAVDDVQAWSSWDEDYRRQIIEAY
HDAGIAIMIAAFGSTDQPTTGGADAKEVAQRLASFVMEYNLDGVDIDYEDMSAMNSARAV
SWIVELQVELRNLLPSPYIISHAPVAPWFTSANDYSDGSYVAIHQQVGDTIDFYSVQFYN
QGADQYVSCEALLTDSGSEWPSTSVFEINAYAGVPLDKIVIGKPLEPSSASNGYMSASDL
HQCVSEAKEKGWNAGVMFWEWSEAAPSVMSTVCG

Enzyme Prediction     

No EC number prediction in CNAG_02351-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	8.06e-31	356	623	2	209	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	6.35e-16	409	619	59	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	3.17e-14	430	621	82	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
226000	Chi1	3.21e-11	373	619	18	302	Chitinase [Carbohydrate transport and metabolism].
119356	GH18_hevamine_XipI_class_III	1.98e-09	423	620	71	264	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR95478.1|GH18	0.0	1	634	1	634
AUB25287.1|GH18	0.0	1	634	1	634
UOH82414.1|GH18	0.0	1	627	1	640
AAW43533.1|GH18	0.0	1	634	1	582
KGB77976.2|GH18	4.65e-273	1	634	1	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	4.55e-19	444	622	92	263	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
4AC1_X	1.07e-10	368	626	16	262	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
4RL3_A	7.83e-09	415	548	64	198	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5FB63|CHIA_FLAJ1	7.33e-08	417	599	1211	1421	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000316	0.999665	CS pos: 16-17. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in CNAG_02351-t26_1-p1.