CAZyme Information: CNA07770-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNA07770-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		91054.93	3.9504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017341.1:2144391-2147090(+)

Full Sequence      

MSAFTYTAALFSLISLLPSALAGPTAGTTYSVSPNQHPSMCLAPANNWEGADVVLKDCDE
DDTTWLWTGQSFQNTATDLCIDIRDYGAWSGNKAQVWGCFSYNTNQQFTVEESMIHWDNF
CWDLTDGSSSAGTMLQIWSCYSYNDNQQWTLTEIEEVDECDATSVTETATIMSTATASVS
DLSTATASVSASNITEAVTATESLTASVNATDPFFTASATDSGYQVNATASATYSSYDVN
ATASATDSGYESINVTASATESGYEFVNATASATLSAETSTATNSSIGEGLWSPHKSSSV
SSDDWSSETATRSNTEWWATSTGSDSWASATASASNPGQNASQSDSWNATSTASNPWETA
SSQASNETSTDSWGASATATASQSDSWDATSTASNPWETASSSQAWNETSTDSWGASATA
TATESGSYGNATSTSTSSAITATATVGTISSGYLQTSGTKIVDSDGNEVILRGTNIGGWL
VLEDWMCGITDTSGSSDRFSLSTLENRFGTDQARTLVEAWAENWLTTSDFDELAAIGFNV
IRLPFSFRTVQNADGSWRDDAFTRMDWAISQAKARGIYTIVDFHMWSGQEADYSAISENT
DEGQSQRDAAGEIWKKVATHYLGESSICAFDVINEPTGSYGDYLQQDLYNAVRSVDANRI
IIHESISTDPSTYGWTNVIYSLHEYDMMGSDLSSNQATWTNGVQAYIDLWHGYNIPFMLA
EFMADGETLDYMLNSMNSQGISWLTWAHSTVNMGRWGIWNHEAFNVDVSSDSYDTIYSAW
TNMPSTFHTSIYDQMKTAATGSTNVSSRKRDLASAARATKRFHGSHGGRSRRNGMAHAVR
GAAGVSI

Enzyme Prediction     

No EC number prediction in CNA07770-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	503	747	6.9e-53	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.72e-21	526	747	26	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	1.06e-16	35	149	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	7.50e-13	469	686	16	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
411418	ser_rich_anae_1	2.13e-11	161	430	249	512	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
395527	Ricin_B_lectin	1.86e-10	72	153	5	86	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41305.1|CBM13|GH5	0.0	1	847	1	847
UOH79756.1|CBM13|GH5	0.0	1	847	1	789
AFR92930.1|CBM13|GH5	0.0	1	847	1	789
AUB22412.1|CBM13|GH5	0.0	1	847	1	789
ADV19959.1|CBM13|GH5	0.0	1	847	1	876

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	8.74e-11	463	695	8	265	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.50e-10	463	695	3	260	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.55e-10	463	695	9	266	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	2.00e-10	463	695	3	260	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	2.04e-10	463	695	8	265	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	4.80e-25	453	689	3	252	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	4.03e-19	470	694	41	279	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	9.97e-17	470	694	41	280	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	9.97e-17	470	694	41	280	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	1.33e-15	465	694	36	279	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999793	CS pos: 22-23. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in CNA07770-t26_1-p1.