CAZyme Information: CNA01520-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNA01520-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: conserved expressed protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		52643.76	4.4867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017341.1:410778-412466(-)

Full Sequence      

MVMFSLDAFIFSTICLLSHLPAAFAFGVQSYPNLFFDASTIVNNEWFNGIDSRWARAMSE
YWAQTLIQYGPWSVTNKSIAAKSGDKKDYLSWAVYHWPDCSNVQNTTELTTEEVWDECDY
VVRDGQVNPDTELVKDKEALQNMSNSIYLSAMAYLHTGDSQYTTHINHALHTFFINNETR
MNPNLNYAQVIRGPGDQMGRHTGVLDLACMAKIVSGVQVMRSIKPVEWQQETETGMMQWA
SEQLDWLYTSELGLAELNATNNHGTFAVNQVCALNVLLNQSDACATALDDFYNGIYLDQI
DANGDQPLESARTRPYHYRAYNLMALVTNAQFGDFVGLSPSAWERRSAANATIVDAVHYA
MLQNYTTSDELNQEKALNPVVAAISAKYGDPDNKYADFLKSTDPYFPGQPWFALNEGLSD
AGIKQGLLETTYGPVPPQPTLGAGSPDDLEYGKKRDWKPRGAGWPTGAPRAP

Enzyme Prediction     

No EC number prediction in CNA01520-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	74	361	3.9e-89	0.96415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.40e-75	73	361	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
234727	algL	4.69e-05	257	333	190	265	polysaccharide lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW40805.1|PL38	0.0	1	472	1	472
KGB74556.1|PL38	1.98e-310	3	472	1	470
AFR92301.1|PL38	4.30e-310	1	472	1	472
AUB21714.1|PL38	4.30e-310	1	472	1	472
ADV20174.1|PL38	1.62e-309	3	472	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	2.35e-28	71	323	45	282	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

CNA01520-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.024121	0.975841	CS pos: 25-26. Pr: 0.9229

TMHMM  Annotations     

There is no transmembrane helices in CNA01520-t26_1-p1.