CAZyme Information: CNA01470-t26_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CNA01470-t26_1-p1
• CAZy Family: PL4
• CAZyme Description: glycosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		71721.03	4.5631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansJEC21	7004	214684	372	6632

• Gene Location: location=AE017341.1:396644-398960(-)

Full Sequence      

MLSLLSSRYTRYSPLLLLFLLGSTFLLFERSSSSSSTLPRSSIYDYTSPATHCFWPGTDA
SDESAATSQPKIPANKGNVGKMKEWIGWGDSEEVDEDVPSGEGFAWEGQLPDVVPVRGIE
RYMLAHIEELQQGYDAKHDYEEYGLKIGNISLSAYTAELLETYKEYLLPPGTPPPNPPPS
FLPIVLSRLSLRPPIAPLPPRPNQVMTTEKSVDDLPWQFQRWKEIMPEWEIKYYDDNALK
NWVRGMFGGTKAEKIWKNLPRQVLKTDVFRYMAMLVEGGIYTDSDTAPIIHADQWGHPYN
HHTSPLLTHLSRILSISTSPHLPSSHPLSSFSPDDAGTIDEELDVDVSTGKSTIYDGPLV
DDGAELGQPSLVVSVESDAIDFGWHNWREVGLSRAVQITQWTFMARPGHPVFLDALGRTL
RKSEEMARKEKEAKKNGEEFIPETALEWTGPGVFSDCVYRYLISRYGFKPDDLIHKKDPL
RVGDVLILPAGSFSSVSPFGDEQQRNWAASWHGFFGRWRGADPGVQEFERLKKLKKEAEE
AEKKAKEEAEEAERKAKEAEQQANETSEQADKSAQDAEEKAKEAAEEAARKAQEASDKVE
ALGEEVEKAKEVAEGKSDGQDGGNGEFTESREETEEEMLV

Enzyme Prediction     

No EC number prediction in CNA01470-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	3.12e-05	218	296	7	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	0.001	257	418	139	242	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW40799.1|GT32	0.0	1	640	1	640
AFR92295.1|GT32	0.0	1	640	1	641
AUB21707.1|GT32	0.0	1	640	1	641
KGB74562.2|GT32	0.0	1	639	1	640
ADV20178.1|GT32	0.0	1	534	1	535

PDB Hits     

CNA01470-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.35e-23	222	519	165	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.19e-15	220	530	125	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.02e-11	196	474	94	368	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.37e-08	256	494	189	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.947043	0.052965

TMHMM  Annotations     

There is no transmembrane helices in CNA01470-t26_1-p1.