CAZyme Information: CLUG_05656-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_05656-t34_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	CH408083|CGC1	66244.14	6.2430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408083:138594-140345(+)

Full Sequence      

MINFSLSRTRTFVLVIVFSSLFLVYIQYENREKQPEEHSLTNVSNTDQTKTSKESEDNFE
YADDITPQFLAEMDSQTSECPNYVDYSKKPHPPYSAGKYKYPYMRPAPKCRTFTSSSLEK
LISDLKRKLKDPDLARLTENALPNTLDTTILWHLAGDANSPPETFVVTGDIHAEWLRDSA
RQLSVFQPLVKYDEQLKNLIVGAIRTQEKYVIKAPYCNAFHPPPASGVKKGDSAVDDVRP
KPDWRYVFECKYEIDSLASFLTLTNDFIENYNGDVSVITPSWITAYERVLTVLKRESQPS
FDPKTGKVLPSMYAFKRKTNIGTETLPLDGAGNPVNFNTGLVRSAFRPSDDATILQFFVP
GNAHMLTELKRTLQNILLKLPDTFEVENHIRYTEMFIKNIENGLKEHAIVNHPKWGKVYA
YEVDGYGGNVFMDDANIPSLLSLPDIGFLDIKDEVYQNTRKMILSKSGNPYFLHGDFFEG
IGGPHIGTSNAWPMSLLMRIRTTDDDKEILDNLEKVMNSTAALGLLHESVNVGKPGGKDY
TRPWFAWCNSEFGKTILHLAKHKPHLIFQDEYATPYSIQSLFS

Enzyme Prediction     

No EC number prediction in CLUG_05656-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	131	557	3e-153	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	131	557	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.25e-147	110	566	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ30555.1|GH125	0.0	1	583	1	583
QFZ36217.1|GH125	0.0	1	583	1	583
QFZ41901.1|GH125	0.0	1	583	1	583
QFZ47577.1|GH125	0.0	1	583	1	583
QFZ53256.1|GH125	0.0	1	583	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	2.25e-100	105	559	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	6.81e-97	105	559	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	9.77e-96	105	559	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	6.79e-73	118	556	12	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.07e-72	118	556	12	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	7.12e-172	80	567	27	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.973957	0.026067

TMHMM  Annotations     

Start	End
12	29