CAZyme Information: CLUG_05134-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_05134-t34_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	CH408081|CGC3	41655.66	6.7720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408081:611314-612393(-)

Full Sequence      

MSSSAFPLEHSRGHGNDATEITLSDDTYSKSYKPAKGNVWATPKRLLGGLAEALTDSAVA
HKKISFAVCILLFLSLFTSVPYVPHLFGPKDPKVVIILAANEGGGVFKWKGPQEWSVERS
SIANKKQYASKHGYGLTIKDMTIKKRYSHEWRESWEKVDLMKQAMRQFPNTEWFWWLDLH
TYIMEPHLSLEKHFLNKLDNATYRTLDTFNPLKIPVEMPYVDYTAPIDMVITQDCGGFNL
GSFLMRRSSWSEALLDIWWDPAMYEQMHMQWEHKEQDALETLYSTQPWIRERVGFLPLRT
INAFPPGACAEQADDPQFFYQEGDFVINMAGCEFGRDCWGEMEHYKALSKKLQKWWKLW

Enzyme Prediction     

No EC number prediction in CLUG_05134-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	92	340	1.5e-87	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.08e-86	90	338	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ46866.1|GT34	2.22e-282	1	359	1	359
QFZ41185.1|GT34	2.22e-282	1	359	1	359
QFZ35491.1|GT34	2.22e-282	1	359	1	359
QFZ29841.1|GT34	2.22e-282	1	359	1	359
QFZ52531.1|GT34	2.22e-282	1	359	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	6.43e-07	81	258	23	172	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	6.00e-137	87	356	115	386	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	2.87e-106	89	358	70	343	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	2.15e-32	84	351	97	353	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.01e-28	84	338	97	339	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	4.04e-24	89	346	81	328	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998911	0.001100

TMHMM  Annotations     

There is no transmembrane helices in CLUG_05134-t34_1-p1.