CAZyme Information: CLUG_05017-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_05017-t34_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	CH408081|CGC2	47898.36	9.3658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408081:385315-386562(+)

Full Sequence      

MASTAHVLIAGFALRAAFFLFGLYQDSHMTVKYTDIDYVVFSDAANFVYQGKSPYLRETY
RYTPLLAWMLVPNAWGGMWVHFGKVLFVMCDILTGVLIARNLPGKTVEKPAFFNKRAVLS
AIWVLNPMVITISTRGSSESVLTFIIMLSVDTLLRDSYTEAAFWLGLAIHFKIYPVIYLP
AFMYYLVLKGQPFGPLKNVPVLKWLNGTNVRFLILTLSSVAFWNWIMYSIYGPEFLYHSY
YYHLTRLDHRHNFSVYNISLYYSSAKSILTSGNVGWAEVAQVWTDNIEKIAFVPQLVLSA
VILPLRFAQSNLSACLFMQTFAFVTFNKVMTSQYFVWFLIFLPHYLASSRLCTKKHALRG
LTMLFLWVISQACWLYFAYKLEFLGESTFDSGLLYSSIFFFLTNCWMLGQFIQWV

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	412	1.5e-86	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.96e-81	1	413	5	416	GPI mannosyltransferase
252941	Mannosyl_trans	1.82e-65	132	412	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ46763.1|GT50	1.11e-299	1	415	1	415
QFZ35388.1|GT50	1.11e-299	1	415	1	415
QFZ29738.1|GT50	1.11e-299	1	415	1	415
QFZ41082.1|GT50	1.11e-299	1	415	1	415
QFZ52428.1|GT50	1.11e-299	1	415	1	415

PDB Hits     

CLUG_05017-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BHI9|GPI14_DEBHA	1.31e-177	3	413	5	408	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|Q5AMR5|GPI14_CANAL	3.58e-154	1	413	1	396	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|P47088|GPI14_YEAST	6.33e-110	9	412	10	386	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q75C82|GPI14_ASHGO	1.39e-104	7	412	8	381	GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.72e-103	14	413	20	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000003

TMHMM  Annotations     

Start	End
7	24
77	99
112	134
166	188
209	231
290	307
320	342
357	379
392	414