CAZyme Information: CLUG_04673-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_04673-t34_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	CH408080|CGC6	45245.31	7.4080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408080:1118936-1120117(-)

Full Sequence      

MSKRFNKYLTITLAVLLCFAFSSKLYSKYTEVYPVPETSNTASDSKIIEPIKTHNEGNEG
HDPAVQNDEEKSQYQQVTTEAKDFTKDVFINNRLKSTRSQQSVLIVSSLANSNSFGSGRS
FEDFVNLIRSLKYDRREVNLAFFCGTQDLYESVITETQKMFDQQSESEFGRVTLIRAPFL
DSPFKASEHSPKVQRKRRRLIARARNFILFSALENEPYTLFLDADVEKFDNPEMLEHFIS
SGKDIIVPRVQRGKLMDYDKNSWRGERKTPSPQELEIMDRNEWSKFKFIPKDVPGKMYHL
GDHLKQLKSPQSDPNLARPDYTIELDSVGGAVLFMKSLIFKQGVTFPPYYIIGTTWQREE
GYDGIETEGICYAAKILGYKCWAMPNMVAQHVN

Enzyme Prediction     

No EC number prediction in CLUG_04673-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	91	349	7.3e-53	0.9440298507462687

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.38e-58	92	349	8	264	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ40297.1|GT62	8.53e-286	1	393	1	393
QFZ51639.1|GT62	8.53e-286	1	393	1	393
QFZ28949.1|GT62	8.53e-286	1	393	1	393
QFZ34612.1|GT62	8.53e-286	1	393	1	393
QFZ45977.1|GT62	8.53e-286	1	393	1	393

PDB Hits     

CLUG_04673-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00314|VAN1_CANAX	3.97e-15	127	392	158	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|O74745|ANP1_SCHPO	5.06e-15	100	392	97	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.83e-14	128	393	111	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|P23642|VAN1_YEAST	9.18e-14	166	392	311	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.911604	0.088411

TMHMM  Annotations     

There is no transmembrane helices in CLUG_04673-t34_1-p1.