CAZyme Information: CLUG_04659-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_04659-t34_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	CH408080|CGC12	62787.23	10.0025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408080:1098581-1100239(+)

Full Sequence      

MKKHSPKKKRAVSNKHNSAVPVTPSNTSAKTVANPFLKSPLYDLLRVFERAPDQWAARYI
LILTAVMLRSAVGLGPYSGQGEKPINGDFEAQRHWMEITSHLPVDQWYFYDLQYWGLDYP
PLTAYHSWIFGKIGGFINSDWFELVKSRGIENSGIKTFMRFSSLISDLLIYIPAVLHLTS
ILSRHLKLGRMHQIVVLTLILSQPPLILIDHGHFQYNSVMLGFFLLSVAELLNGSLVFAS
IWFMSSVLFKQMALYYSPFIFFIILARLFTPSTTIPKTLTSFKFGNLLAVGLSVFLTTVA
SVSPFILTSSTWTDACVLLKQILVRMFPFERGLFEDKVANFWCTTNLVVKYNKLFTNSQL
KTASLVLTLTFALPPCLLCFKKQLIQKSTSPALVLYGFSACAWAFYLFSFQVHEKTVLVP
LIPSTFLLVTKDRDTISIIHWINNISTFSLFPLLKKDGLVLQYGVTSLLINWLIGGFTLK
RKNNLLWPHNSSICLKLIIGLSYLAIIVFHIIDYSIPAPVRYPDLWVIANTTISFGCFGT
FYLWLLHKVYYL

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	66	545	3.6e-144	0.9937629937629938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	8.01e-161	87	541	15	472	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ51650.1|GT57	0.0	1	552	1	552
QFZ28960.1|GT57	0.0	1	552	1	552
QFZ45988.1|GT57	0.0	1	552	1	552
QFZ34623.1|GT57	0.0	1	552	1	552
QFZ40308.1|GT57	0.0	1	552	1	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	6.68e-149	30	550	29	552	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12001|ALG6_YEAST	1.93e-148	30	550	11	534	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG6 PE=1 SV=1
sp|O43053|ALG6_SCHPO	3.77e-124	39	549	9	489	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg6 PE=3 SV=1
sp|Q54QG6|ALG6_DICDI	1.30e-95	60	535	20	493	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q9VKX7|ALG6_DROME	1.43e-84	68	544	15	464	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=gny PE=2 SV=2
sp|Q802T2|ALG6_CHICK	5.99e-81	53	534	2	478	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999907	0.000089

TMHMM  Annotations     

Start	End
221	243
253	271
284	306
363	380
393	412
460	479
492	514
524	546