CAZyme Information: CLUG_04461-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_04461-t34_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	CH408080|CGC9	46726.64	4.5219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408080:741084-742325(-)

Full Sequence      

MKLLVSLASLATSVLAASVPLSKRSSSWDYQNDKVRGVNLGGWFVLEPYITPSLFEPFGS
NIPVDEYHYCQTLGKDEASDRLQKHWSTWYTEDDFEAISAAGLNTVRIPIGHWAFVTVDG
EPYVQGQQKYLDLALQWARNHNLKVWIDLHTAPGSQNGFDNSGLRDQIQYQQDANIAATL
TALQNIFNKYGGDEYKDVVSGIELLNEPLGTVSDMNQLENFYQWAYKNMRSVSTNNVIIH
DAFQPFNYYDSFMQADGGYYNVVLDHHHYQVFSGGELSRDINAHLSVACGWGSSAATESH
WNVCGEFSAALTDCAVWLNGVGRGARWSGDYDNSPNFGSCDMYVNPDNWTSDHKTNVRKY
IEAQLDAFEHTGGWIFWNWKCEDAIDWDMSRLIDVGVFPQPLDSRQYPGQCQY

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	84	382	1.3e-123	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.62e-84	29	412	12	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.16e-08	85	239	15	164	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ34803.1|GH5_9	0.0	1	413	1	413
QFZ40488.1|GH5_9	0.0	1	413	1	413
QFZ46168.1|GH5_9	0.0	1	413	1	413
QFZ51830.1|GH5_9	0.0	1	413	1	413
QFZ29140.1|GH5_9	0.0	1	413	1	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	9.39e-190	27	413	1	393	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	7.67e-189	27	413	1	393	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	9.51e-189	27	413	7	399	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	2.72e-188	27	413	7	399	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	2.72e-188	27	413	7	399	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12700|EXG_SCHOC	2.59e-196	16	413	23	425	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|P29717|EXG1_CANAL	2.32e-188	27	413	45	437	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q8NKF9|EXG_CANOL	2.63e-184	10	413	11	425	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|O93983|EXG2_WICAO	9.31e-183	23	411	30	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12628|EXG_KLULA	2.44e-171	5	411	7	425	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999594	CS pos: 24-25. Pr: 0.9571

TMHMM  Annotations     

There is no transmembrane helices in CLUG_04461-t34_1-p1.