CAZyme Information: CLUG_03657-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_03657-t34_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		68561.01	9.2861

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408079:899093-900859(-)

Full Sequence      

MGEQMISRDYFYLGTKLPMDRFLSFYYAHAGFHINNMSIILSLQLFLLVGINLGVLADSS
TICEYNKSQPFTDPRRPKDCLNLIPVLLWLRRCIISIFVACIISFLPLGFQELTERGCYT
CLKRLGKQILSFSPFFEIFVCKIYTHSLVSDLNYGGAQYIATGRGFATQRISFVPLYSRF
ANASLKFGFESFVLMIYISYYVWNFSLLYFWIIVCGLLYSPFLYNPNEYVFMDFFLDYKD
FWTWLFSIIEKEEKQTWYSYTKLRRGQISGFIISSLMKRDFNVTSANRPSRLHLITTIII
PKTLKTLVIGCAYLFANCQSGFTPGSYSYATKRILLVSLFPLVSNMAILLTFFVFSLIFV
PFFTMLFKHLPSVIFIIVHSFSILNYIISFELVWYLQGFNICQTILSIILSIKVQELILE
TMNITLLSRELDHENVCKAWWSGKWVTAGLGWRIIPQPFREFVCKISELTYFAEDFFLGQ
FLFLSQSPLLLIPYINKWHRMMLFWFKPDTEKNQKGTYQAQKTKSHFAIAFFIVFIMCSL
FSALLVIFPVFLAGRYDIDGIIPSWLHELKQPKRGSIAYSAQYPGLRK

Enzyme Prediction     

EC	2.4.1.34:56

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT48	1	321	1e-82	0.428958051420839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396784	Glucan_synthase	1.87e-153	1	363	456	819	1,3-beta-glucan synthase component. This family consists of various 1,3-beta-glucan synthase components including Gls1, Gls2 and Gls3 from yeast. 1,3-beta-glucan synthase EC:2.4.1.34 also known as callose synthase catalyzes the formation of a beta-1,3-glucan polymer that is a major component of the fungal cell wall. The reaction catalyzed is:- UDP-glucose + {(1,3)-beta-D-glucosyl}(N) <=> UDP + {(1,3)-beta-D-glucosyl}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ34079.1|GT48	0.0	1	588	1013	1600
QFZ28416.1|GT48	0.0	1	588	1013	1600
QFZ51109.1|GT48	0.0	1	588	1013	1600
QFZ45445.1|GT48	0.0	1	588	1013	1600
QFZ39763.1|GT48	0.0	1	588	1013	1600

PDB Hits     

CLUG_03657-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04952|FKS3_YEAST	3.60e-127	1	508	1179	1687	1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKS3 PE=1 SV=1
sp|A2QLK4|FKS1_ASPNC	1.29e-117	1	511	1294	1805	1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=fksA PE=3 SV=1
sp|P40989|FKS2_YEAST	7.42e-116	1	576	1285	1866	1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSC2 PE=1 SV=2
sp|O93927|FKS1_CRYNH	1.83e-112	1	564	1233	1791	1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FKS1 PE=3 SV=3
sp|P38631|FKS1_YEAST	5.86e-112	1	511	1266	1779	1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996450	0.003534

TMHMM  Annotations     

Start	End
34	56
88	110
201	223
294	316
336	358
373	395
527	549