CAZyme Information: CLUG_03511-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_03511-t34_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		67125.55	8.3363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408079:641201-642952(-)

Full Sequence      

MFLTMKALKFSVLACVLSSAIVAFDNAQIIDSRLILLDATLILSVALTMLSYAKFSTYRR
QPFSKWWWTWLLATGVSLSCVISTKYVGVFTYFTIGLGVLHELWILLDIKKGLTMEEFTQ
HFLARFFTLIVFPFCIYLFWFYLHFAILTRSGPGDAFMSADFQESLQESPLAKESKNVNY
YDMITIKHKDTESYLHSHEFKYPLRYESGRISSNQQQVTCIVDKEGNAIADANSHWEIIP
TTDAKKGDGVFTNDIVRFRHVGTGGYLLTHDVASPLRATNEEFIVVHDEAAQNRYNETLF
RLRLAEPGKSNQNKRVQVKTLGTVLRILHMDTVVAMWTHNDELLPEWGLGQQEVSGNKKV
QDKDNIWTFERIVNMDPTDVRQHYIPKTVKHIPFLKKWWELQGLMFMHNNLLSSEHPFAS
QPDAWPLSFSGVSFWNDNDLRQQIYFIGNVVGFWLEAGFLAIFVGFVLADLVTTRRAVNI
LNHQSRSRMYNTLGFLFVGWAAHYFPFYLMNRQKFLHHYLPAHLIAALFTGGFVEFICTN
KGFTNSNGVPPLGLQKRKLLLSTAAIIVALVWYLLVHESHHLW

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	1	145	3.7e-31	0.6322869955156951

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	5.98e-137	1	545	127	648	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
406576	PMT_4TMC	4.82e-57	396	576	1	170	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
396786	PMT	2.68e-38	1	149	100	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	1.76e-18	187	367	4	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	4.80e-12	178	240	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ45302.1|GT39	0.0	1	574	146	719
QFZ28273.1|GT39	0.0	1	574	146	719
QFZ50966.1|GT39	0.0	1	574	146	719
QFZ33936.1|GT39	0.0	1	574	146	719
QFZ39620.1|GT39	0.0	1	574	146	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	1.13e-57	2	573	167	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	2.41e-50	1	537	152	674	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	1.19e-11	165	367	5	184	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]
1T9F_A	1.48e-10	178	290	7	109	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	2.05e-294	1	573	151	722	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	2.16e-194	1	537	156	684	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.74e-144	2	550	163	706	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.73e-61	8	522	148	669	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	9.93e-61	2	540	170	694	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000000

TMHMM  Annotations     

Start	End
7	24
34	53
66	83
87	106
126	148
450	469
490	509
519	538
559	576