CAZyme Information: CLUG_02966-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_02966-t34_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	CH408078|CGC1	35940.54	4.7867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408078:1360838-1361896(+)

Full Sequence      

MLFKSLVSAALAATALAQPVQQHQHHQHAKKDQITHTVIVTAGAPAPSYAAAVEVSSAAG
SAPAASAPASSGAAPVASGSSSSSSSSSSSSSGSGSFSGAAKAITYSPYADDGSCKDAGT
VKSELSKLSGFEVIRIYGVDCNQVPNVLAGLSSGQKIFAGIYNTDNISGDIETLASAVKN
AGGWDIVDTVSVGNELVNGGQATVSQVAGYVKEARSALSSAGYNGPVVAVDTFIAVINNP
GLCDCSDYMAVNAHPYFDGGVTAEESGEWVLQQLQRVSSACSGKKVFITETGWPTRGNSN
GKAVPSQSNQAAALSSISETCGNDVTFFTAYNDMWKQDGSWGVEKYWGIYSE

Enzyme Prediction     

No EC number prediction in CLUG_02966-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	105	351	7.1e-27	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.04e-94	101	351	45	302	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.68e-06	111	351	12	298	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ50371.1|GH17	3.64e-195	1	352	1	351
QFZ27351.1|GH17	3.64e-195	1	352	1	351
QFZ44694.1|GH17	3.64e-195	1	352	1	351
QFZ33341.1|GH17	3.64e-195	1	352	1	351
QFZ39012.1|GH17	3.64e-195	1	352	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.45e-14	111	349	45	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.73e-13	111	349	45	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.29e-115	98	351	123	377	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	1.17e-108	101	351	136	387	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.27e-104	97	351	129	384	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	1.24e-55	102	349	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	7.14e-55	104	350	311	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999669	CS pos: 17-18. Pr: 0.9649

TMHMM  Annotations     

There is no transmembrane helices in CLUG_02966-t34_1-p1.