CAZyme Information: CLUG_02427-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_02427-t34_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	CH408078|CGC6	30194.18	9.8689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408078:260724-261518(-)

Full Sequence      

MRYTAVTCGPSNFWRDGYILRPIHYPQRRHTEMMVVITMYNEDDILLARTLKGVFKNIKH
LESKTSSRMWGKDSWKKIVVCIVSDGRSKINERAQALLASMGVYQEGLAKSRIDDKKVKA
HMYEYTTRVRVSSVTDTVKLTTEKVVPVQMLFCLKETNAKKINSHRWCFEAISQVLEPNI
VVLLDCGTQPSGKSLYHLWKEFDRDPQVAGACGEIKASLKKRQMLTNPLVYAQNFEYKIS
NILDKPTESVFGFISVLPGAFFGL

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	39	202	4.8e-74	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.51e-106	39	202	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.06e-52	35	261	1	153	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	6.67e-15	1	38	35	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	1.18e-12	35	262	1	159	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	7.34e-09	180	261	204	281	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ32828.1|GT2	4.97e-182	1	261	247	507
QFZ49858.1|GT2	4.97e-182	1	261	247	507
QFZ44180.1|GT2	4.97e-182	1	261	247	507
QFZ27865.1|GT2	4.97e-182	1	261	247	507
QFZ38498.1|GT2	4.97e-182	1	261	247	507

PDB Hits     

CLUG_02427-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	1.02e-154	1	261	280	541	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30588|CHS3_NEUCR	1.34e-109	1	261	185	445	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30583|CHSC_EMENI	1.53e-106	1	261	215	475	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|Q12564|CHSA_AMPQU	6.16e-103	1	261	201	460	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|P30601|CHS2_EXODE	2.36e-102	1	261	224	484	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLUG_02427-t34_1-p1.