CAZyme Information: CLUG_02426-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_02426-t34_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		57184.51	8.4008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408078:259325-260827(-)

Full Sequence      

MHKILSIKSPIFLTSLSSRCLDLSSCYSAHFSAYRYMALQNDINGQGPLEKYFKGEFLHG
IGELDLDDDEYEMKSRLLSEEAGIFTSNMYLAEDRILCYELVAKRGHAWLLRYVKSARAE
TDVPEGLAEFILQRRRWLNGSFFAAIYSLVHFPKIWTSSHTLGRKIMLHVEFMYQFVSLV
VSWFSIGAYFLVFRILTTSLADSDLNFSPGNVLSVLFLWLYLASIVTTFVLSFGNKPKGT
ERFYIVIVLFFAVLMVYMIFAAIFMAVHAIKSITDHHKSITVALFFKNEEFRDLVVATCS
TYLLYFVASFMYFEPMHMFTSFLQYLLLSPAYVNVLNIYAFCNIDDVSWGTKGDTGAKDL
GSATIREDGTFDVKIPVLKEEINQSYLNQLEKIKDPQAPSKGGSDGTNEDYYAFIRSMTV
LVWMFSNFLIVALVLETGGVNQLSKKKDNVSSRSKAFLTVILWTVAFMALFRFIGCTVYL
IRRGRNYLRSGRSAQRQPMM

Enzyme Prediction     

EC	2.4.1.16:26

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	6.47e-27	31	144	153	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.51e-12	87	265	233	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ32828.1|GT2	0.0	31	500	507	976
QFZ49858.1|GT2	0.0	31	500	507	976
QFZ44180.1|GT2	0.0	31	500	507	976
QFZ27865.1|GT2	0.0	31	500	507	976
QFZ38498.1|GT2	0.0	31	500	507	976

PDB Hits     

CLUG_02426-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	5.81e-241	31	483	541	996	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30583|CHSC_EMENI	2.24e-136	31	483	475	913	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30601|CHS2_EXODE	1.72e-134	31	483	484	916	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30588|CHS3_NEUCR	3.93e-133	31	483	445	883	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|Q12564|CHSA_AMPQU	6.69e-129	31	483	460	897	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

Start	End
174	196
211	233
245	267
294	313
420	439
459	481