CAZyme Information: CLUG_01684-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_01684-t34_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	CH408077|CGC3	35853.27	6.8867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408077:932788-933759(+)

Full Sequence      

MSFQTYSVALLVTAFLAVYGAVLFFSHHPRPPTESESKYMTNDGKGQVHNLPPRASPSDK
IEKGKTLLSVVVPCYNETSRLGKMLDEAVEYLEKNLKDEYEIVIVDDGSSDGTADFALEK
ATMLNLSPHVLKVVRLSQNRGKGGAVRHGILHGKGKYLLFADADGATKFGDSGRLLEFLQ
SQPEGKPAIAIGSRAHMVNTDAVVKRSLVRNFLMYGLHTLVFIFGIRQIQDTQCGFKMFN
RESAQIIFPHMHTERWIFDVEVLLLGGMQGVEMKEIPVNWQEIDGSKVDLARDSIQMAID
LVVTRMAYLMGVYGLDESGHKSA

Enzyme Prediction     

No EC number prediction in CLUG_01684-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	244	6.4e-28	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	8.64e-101	70	287	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	8.36e-97	10	313	13	321	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	1.94e-54	70	264	1	183	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	1.97e-29	69	243	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
223539	WcaA	2.06e-23	65	311	2	238	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ26564.1|GT2	8.13e-235	1	323	1	323
QFZ32232.1|GT2	8.13e-235	1	323	1	323
QFZ37901.1|GT2	8.13e-235	1	323	1	323
QFZ43584.1|GT2	8.13e-235	1	323	1	323
QFZ49261.1|GT2	8.13e-235	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	5.66e-08	68	245	25	190	Dolichyl phosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
5EKE_A	3.91e-07	68	164	28	119	Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	3.91e-07	68	164	28	119	Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5HEA_A	7.90e-07	67	164	6	94	CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40350|ALG5_YEAST	2.39e-105	10	313	18	328	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|O60061|ALG5_SCHPO	1.88e-83	12	313	15	313	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|Q54J42|ALG5_DICDI	1.17e-77	28	317	37	327	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9DB25|ALG5_MOUSE	2.48e-67	11	318	15	320	Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1
sp|Q9Y673|ALG5_HUMAN	5.53e-66	9	318	13	320	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
7	29