CAZyme Information: CLUG_01658-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_01658-t34_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	CH408077|CGC11	43234.67	9.0529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408077:884564-885691(+)

Full Sequence      

MVGPRRKLRIGIISIVLLFLLYTFVSTVSVPRHVTKTELSTNKLKLARELEKNSNWKKTG
LNFHTNKAANLPALSTLRQQLSFQFPYEPSKGFQKNIWQTWKVGLNDETFPTTYRGYQET
WEALNSGYKHYVIPDDECDTMVKQLFASVPDVAQAWSLMPKNILKADFFRYLILYARGGV
YSDIDTKCLKPIDTWVSKNQTIYGIDNHAGLVVGIEADPDRPDWAEWYARRIQFCQWTIQ
AKKGHPMLRELIAKITELTLQRWKNGELKKIKGKDSGGDIMNWTGPGIWTDMVFEYMNNI
LQPQENFERKKYDEIVTWKLFTGMEMPMAIEDVLILPITSFSPDVNQMGAQSSSHELAYA
KHLFSGSWKDNGPSE

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	198	4e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.45e-47	64	370	53	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.03e-18	115	200	5	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ43557.1|GT32	3.59e-287	1	375	1	375
QFZ32205.1|GT32	3.59e-287	1	375	1	375
QFZ37874.1|GT32	3.59e-287	1	375	1	375
QFZ49234.1|GT32	3.59e-287	1	375	1	375
QFZ26537.1|GT32	3.59e-287	1	375	1	375

PDB Hits     

CLUG_01658-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.47e-185	5	375	11	382	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	5.65e-105	66	371	71	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.71e-75	83	371	134	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	9.89e-69	72	370	109	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	5.12e-07	90	208	54	170	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995791	0.004225

TMHMM  Annotations     

Start	End
12	34