CAZyme Information: CLUG_01403-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_01403-t34_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		48755.11	9.0634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408077:396514-397830(+)

Full Sequence      

MVHVSHNYSRSAPTSPLQHLLITMRLLSLFLASKAAQFVLLSLVPAQFDTSSQILLSHHR
PEKYALVSAFPIPLQKAAEFVLSRVVDRLVVWDAVYFSHLFTNGITYEHENVFCPLWWRL
VSFCSRQLGCHNFYSRFLCATLLSCTAHYAATLVLGAYTRLVFQDARLFSPQRMARAAQV
VFVISPAGIFLTAPYAESAAALCSFACLYLRESGTLQGVGSLYVASGIFAALAYGMRANC
LLLGGVYLWDVAWPRTAGVLVGPGLTARRIWALAAGCILGASFVASNVANYVSVCSLGRG
EWCDQVVPSLFAYAQSHYWNVGFMRYWSANNIPNFMFAIPVVTLSVVSIRYFQYEYPVDR
VSAVSAVNGLFVMMVVLFWHVQIVTRIHTFLPSVYWLMAGFFTQKGLTGARWGRWCMAYM
VVWCAVQTAMFGAFLPPA

Enzyme Prediction     

No EC number prediction in CLUG_01403-t34_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	27	438	9.1e-88	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.26e-32	26	438	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.22e-17	142	438	121	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ31955.1|GT76	0.0	1	438	47	484
QFZ43308.1|GT76	0.0	1	438	47	484
QFZ26287.1|GT76	0.0	1	438	47	484
QFZ48984.1|GT76	0.0	1	438	47	484
QFZ37624.1|GT76	0.0	1	438	47	484

PDB Hits     

CLUG_01403-t34_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BRZ9|GPI18_DEBHA	1.41e-101	30	438	11	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	1.63e-71	25	438	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.45e-58	26	438	7	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6FWN4|GPI18_CANGA	2.58e-44	30	438	11	433	GPI mannosyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	4.44e-43	25	438	6	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998113	0.001896

TMHMM  Annotations     

Start	End
26	48
137	159
180	202
227	249
270	292
332	354
361	383
387	409
416	435