CAZyme Information: CLUG_01181-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_01181-t34_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844		93336.90	5.4450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408076:2365873-2368407(+)

Full Sequence      

MTKLDVEALITELSLPEKISLLAGANAWQTVPIERLNIPAVTVSDGPNGIRGTRFFDSVP
SNCFPCGTGMASTFNKELLYQAGELMSKEAKMKGVHCILGPTCNIARGPLGGRAFESYSE
DPVLSGHIVSAVINGIQDGKIVACIKHFVCNDQEDERKGVDTIITERALREIYLKPFQLA
VRDANPKSFMTAYNKVNGEHVSQSKKLLEDVLRKEWGWDGMVMSDWYGVYSIKESLDAGL
NLEMPGPTRFRESVQTVHSVVCNEIHRDVIDKNVRHVLKFIDDCLESGVDPDQDELENTD
PKAATLLRQIGGESLVLLKNDDNILPLDPHAKKGNEVIAVIGPNAKAERNSGGGSASLKA
RYTVTPFDGIVNKVKEKAGDKAVVVEYTLGAYLDKTLPDIGSIMKTETGETGVEARFYKV
APGTPGRKPFDKRISTSTKLFLTDYKHPELPVGEQLFYVDFEGYFTPDESATYEFGCSCL
GTAQIFLDDKLIVDNKTKQQRGDAFFLGMGTREERSAVKLEKGKKYKVKVEYGTRPTSSL
IVDYQEVGGVYFGAQIKNTHEEALQKAVDLAKKADKVIVVGGLSKEWESEGFDRPDMDIP
GYTNKLVEAVSDVNPNVIFVNQTGSPVTMPWVHKVKGLVQAWYGGNELGNAIADVLFGDV
NPSGRLSFTFPEKLEHNPSYLNYGSTNGRVLYGEDVFVGYRHYEMVDRKPLFPFGYGLSY
TTFEFKNAKAEVGEKTVTVTVDVTNTGKRDGSEVVQIYVSHENPRIIRPAKELKDFAKVF
LKSGETKSVSVEMPLLEVTSYWDSYKNQWLSEKATYHALVGASSDNIVGDAVFSTEKDVY
WLGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	6.2e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.37e-71	29	824	95	754	beta-glucosidase BglX.
224389	BglX	2.03e-70	27	380	49	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.17e-59	315	720	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.72e-40	29	278	57	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.53e-32	8	726	55	639	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ41967.1|GH3	0.0	1	844	1	844
QFZ47643.1|GH3	0.0	1	844	1	844
QFZ30615.1|GH3	0.0	1	844	1	844
AGG38816.1|GH3	0.0	1	844	1	844
QFZ26082.1|GH3	0.0	1	844	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.37e-277	1	844	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-270	2	844	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.02e-144	5	828	4	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.42e-123	10	838	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.42e-106	6	838	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	8.90e-286	1	844	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.58e-285	1	844	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	7.19e-285	1	844	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	4.25e-284	1	844	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|A1CA51|BGLI_ASPCL	2.34e-283	1	844	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999464	0.000567

TMHMM  Annotations     

There is no transmembrane helices in CLUG_01181-t34_1-p1.