CAZyme Information: CLUG_00447-t34_1-p1

Basic Information

• Species: Clavispora lusitaniae
• Lineage: Ascomycota; Saccharomycetes; ; Metschnikowiaceae; Clavispora; Clavispora lusitaniae
• CAZyme ID: CLUG_00447-t34_1-p1
• CAZy Family: CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
966		107188.39	5.8705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ClusitaniaeATCC42720	6153	306902	217	5936

• Gene Location: location=CH408076:901302-904202(-)

Full Sequence      

MRLVALVIGMKWFLLLSACVLPVPAAEGPDIEWYKWGLPKERDMEDMKGDMEGMVVGDME
GDMEGDMEARDMEAIGVEAIDMEDASAISIASREASISTEATETTTASTGPKERGAEPEQ
ESEQPEPEAESEAEPEPESNRPESFLAEHVSAEPSFAAESGSFSSAAFTPAHLRSLRARA
GALFAHGWRAYRTVFPADEVRPLSCRALGPDRTDAFNLRNDAMGNVASTALDNLDTLILM
RQWHELAFVLRHLEKHQHHYFAQNATVQVFEAAIRWLGGLLSAHLLLSEIPQVQAVFPAY
DGFLLHMAHDLGRRLLPAYNTPSGIPLARINLAGHAVPPALNAETCTAGAATPVLEMTLL
SRLTGDGRFERHAARAFWALWRARSRAGLVPSAVDPHRGAWLNAATGVGASVDSFYEHAL
KGAIVFGDARLMDVFVRSYEALSAHSAQSVSGAAAYFALADTGSGAVAAPWIDSLGAFWP
GLQVLAGRLSDAVASHVVYMKIWNTFDVLPERWIFAAPPTGRSGQPGQQGRSVEPVRSVQ
SAVPLEWYPLRPELIESTYYLYRATRDAMYLEMGVRFLEAFETRFKDRCGFAGVQDVRTG
ERQDRMETFVLGESLKYLALLFDEATFLHTGMPGNWVFSTEAHPLWYTPGLGRRHAARFK
RKRARREIKKTKRQEGKSGKMNDIEKMKMDDVDTEYTDDIEYIDDIEYTDDIEYIGSDDN
SVFSSLWARLRSKDADGIEPAAPRLPFGPGIPPVASLLDSCEVRPQQFRPHRGPLASSAY
TRWPHLFLADARFRPTLVRPDYLGPQRSFELGASFLATHALGSPLQCAREPTSSELDVIL
DTLRRPEDYAMYVVRRPRPDHAFAKGDYVMPQLSGRLLLECVSAGSVDWANRRVSRAFVR
ARRPEMWASASAEVCRVAKLNGVAVARNATVWMERRHAETQSGVFTVACNGRIFIEGKYL
DNVRVY

Enzyme Prediction     

EC	3.2.1.113:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	184	646	1.7e-126	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.04e-143	183	646	1	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.21e-62	184	645	80	516	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ37004.1|GH47	0.0	1	966	1	983
QFZ48364.1|GH47	0.0	1	966	1	983
QFZ31336.1|GH47	0.0	1	966	1	983
QFZ25361.1|GH47	0.0	1	966	1	983
QFZ42688.1|GH47	0.0	1	966	1	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X9D_A	2.10e-41	169	645	81	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
1FMI_A	2.41e-41	170	645	4	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.50e-41	170	645	4	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	5.30e-41	183	645	12	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	2.52e-40	183	645	12	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38888|MNL1_YEAST	2.25e-106	168	646	27	501	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	4.04e-93	165	643	114	577	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	2.37e-92	165	643	119	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|O94726|MNL1_SCHPO	4.44e-89	167	643	26	473	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q9FG93|MNS4_ARATH	6.88e-84	170	659	34	487	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000635	0.999365	CS pos: 18-19. Pr: 0.7313

TMHMM  Annotations     

There is no transmembrane helices in CLUG_00447-t34_1-p1.