CAZyme Information: CLCR_10387-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_10387-t43_1-p1
• CAZy Family: GT69
• CAZyme Description: putative alpha-1,6-mannosyltransferase MNN11

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	LGRB01000008|CGC8	41392.24	8.0339

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000008:2487004-2488142(-)

Full Sequence      

MHFALPPRKTSHPPPYVRNSNLAAAAQRRRKQIQLLAYVVFGVLTVYLLLKALLSFRAAD
SRDAGASSIDGPQDIVIVTVFDHATMSEEYMGIVRLNRDDYAARHGLGYKNFYTNTTAYL
NLVDPSPSSWSMIPALRHALTEMSTSTFFWHLSADALITNPSLSLESHILQPLDALMLKD
IPVVPPDSVIHTFAHLKPARTHLILSQDMDNLAHTSFILRNTPFSLQTPDNWAHYFLDAW
FDPLYRAYAFQKAENHALEHLVQWHPTVLAKLVLIDQRRINSYNYASPPSKDPLTGDIRT
HDSMWQEGDLVANLKGCRDGTMRDCEEEMRYYYAKWKKEVERLDGKKPDYDRSAPKLKPV
RGS

Enzyme Prediction     

No EC number prediction in CLCR_10387-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	74	326	1.8e-56	0.9796747967479674

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	3.40e-55	73	325	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01218.1|GT34	6.50e-91	1	336	1	311
BCS12963.1|GT34	6.50e-91	1	336	1	311
AAY62606.1|GT34	2.61e-90	1	340	1	315
QGA17602.1|GT34	9.25e-90	1	340	1	319
QSS60522.1|GT34	2.62e-89	1	340	1	320

PDB Hits     

CLCR_10387-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	1.70e-26	42	333	15	307	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	2.50e-22	82	317	115	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|P46985|MNN11_YEAST	1.18e-20	68	338	154	421	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q10359|GMH3_SCHPO	1.28e-18	70	317	79	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P50108|MNN10_YEAST	1.93e-17	92	332	147	375	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000018

TMHMM  Annotations     

Start	End
35	54