CAZyme Information: CLCR_10160-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_10160-t43_1-p1
• CAZy Family: GT50
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase DCW1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		49813.05	4.8699

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000008:1411486-1412916(+)

Full Sequence      

MPGLILSVILFLGFLSRTAVGIALDVDDTESILAAAALGAHKVIGLYSGNQTGGTQGKWP
FPPYYWWESGGAWGGLMEYWHYTGDDTFNEVMQEALIAQLGPKKDFNVPAEAFDTGNDDQ
AFWVFVAMAAAEYSFPRLPAPNPSWIQIVNNAWQDYVFRWNTSGCNGGLKWQFNPNNAGY
YYKNSISNGAFFQLSARLARFTGNETYVHWAETVWNWARGIGLIDSIYNVYDGTDELINC
TGIDHHQWSYNVGAFLYGAAVLQNFTNGSSPWIDRTAGLLAATNTFISPFQNASNMMFEA
ACEISNTCNTDQLSMKAYLIRWMAATSKMAPFTAGRIGEVLRASAQGAAASCTGGKTRNT
CGSKWYLGRWDGTTGLGQELCALEATYALLVNQTNPPAVYPHVGISTAAPSPTIPVTATD
SLPAASDSARPLHDGAPATPSTMQTKVLIAALFTSLTIM

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	393	4.7e-85	0.9357541899441341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.21e-147	31	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.02e-07	118	290	93	251	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76159.1|GH76	7.80e-168	18	452	13	455
BCR93001.1|GH76	3.73e-130	22	396	29	401
BCS05661.1|GH76	3.73e-130	22	396	29	401
CCD44408.1|GH76	2.97e-129	16	397	18	393
QSZ36627.1|GH76	4.21e-129	16	397	19	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.26e-91	26	398	30	411	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	8.92e-103	12	384	12	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	6.09e-102	8	384	4	376	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	6.67e-102	14	384	14	379	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.05e-101	19	391	17	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	3.17e-94	7	397	4	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999742	CS pos: 21-22. Pr: 0.9722

TMHMM  Annotations     

There is no transmembrane helices in CLCR_10160-t43_1-p1.