CAZyme Information: CLCR_10078-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_10078-t43_1-p1
• CAZy Family: GT4
• CAZyme Description: glycoside hydrolase family 30 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	LGRB01000008|CGC21	48967.50	4.5458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000008:1156592-1158135(+)

Full Sequence      

MEALLVVALATGASAWSYATNMTYSATITVDAAQKYQTMIGGGCSGAFGIACQHFGSVGL
SPANQELVTQILFDENIGGLSIVRNDIGSTPGVVRGDVASILRDCPPTPAGPFNYVWDGN
DTCQLQLTKTALKYNPNAYVYADAWSAPGCMKTVGTEDNGGFICGVRGSSNCSGDWRQAY
ADYLVQYVKFYEQEGIEVQLLGAYNEPDFNPVKYASMESDGYQAKDFLEVLYPTAKAAFP
NISIACCDATGARQQRNILYELEQAGGADLFDVATWHNYQSNPERPFNSNGKPNMMTEWA
DWALYMHNAFVNSDTSGYTHWYCAQNSTGDNALIRLNHDDYFVSARLWAFASYFRFARPG
SVRIEASSNAEHVYVSAYVNTNGTVAIPVINAAHFPYQVTINLNGISATTATAYLTDNEH
NVTMAGQTQIGGSFQVTVEPRAMKTYFLS

Enzyme Prediction     

EC	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	26	446	2.3e-142	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.03e-20	25	446	33	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	6.76e-10	124	238	80	193	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	7.83e-05	360	446	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57081.1|GH30_7	5.11e-241	14	448	16	464
UKZ82812.1|GH30_7	5.11e-241	14	448	16	464
QYT04915.1|GH30_7	6.89e-239	5	448	7	464
AAV25955.1|GH30_7|3.2.1.-	3.25e-237	5	448	7	464
AAP64786.1|GH30_7|3.2.1.-	3.25e-237	5	448	7	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	1.07e-85	26	446	22	469	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	9.93e-85	28	446	95	540	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	1.04e-71	27	448	4	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	1.71e-70	27	449	24	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	1.71e-70	27	448	11	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	9.42e-72	1	448	1	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q45070|XYNC_BACSU	3.10e-11	124	433	97	404	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	7.34e-11	124	422	98	394	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|O16580|GLCM1_CAEEL	2.75e-09	28	448	87	518	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012082	0.987878	CS pos: 17-18. Pr: 0.7353

TMHMM  Annotations     

There is no transmembrane helices in CLCR_10078-t43_1-p1.