CAZyme Information: CLCR_09723-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_09723-t43_1-p1
• CAZy Family: GT33
• CAZyme Description: DUF1680 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665		75244.53	6.4697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000008:3234457-3236584(-)

Full Sequence      

MTYPQETFTQTSLTPGSLIWQRRETAARKTLFYQLQVLKDTGRYDAFKLQWHPSYADAPD
VWPIPNHLFWDSDVGKWIEGACYFLHDHPNQEISSAVHELTQMIASAQRPDGYLNIHFTV
VEPGKRFTNIRDFHELYNAGHLIEAALAHHRLYQNNDLLEPLLKYVELLCRTFGPKEGQI
PGYPGHPEIELALLRLWQRTRDPKHLELAKYFITERGRLGANGEHYYRVEAKARGEEPHA
RMPYWGGGDPLCYYQAHKPIIQQKTIEGHSVRAMYLLTAVSDLVGMEPATTACLKEAVYR
LWHNMVGCKMYVTGGIGAIKQWEGFGPDFFLPQGTDEGGCYAETCAAIGVMMLADRILQY
DLDRQFSDVMELCLYNAVLTAMSHDGTKFTYVNQLASSEPNPSTREEWFTCACCPPNVLR
LLGQVGGYIYSRAEGQEEQVNVHLYIPSEHRFQSSDDLPVTLVQKSDWPWKGQVEFELKT
ESSRVRVALRVPGWARSWKVSPSPPTTDLEKGYLILPADWVAAHPRFTLTVDMSPRLVAP
HPYTNQDIVALTRGPIVYCVEDVENAWVKDHFKGVQLDPACSVGEKVVSDATTGDQYVAL
TVAKDASIVRRDLIHAEPGVDVDLLGGVVRAGGSVIDELNFIPYYFRASRGGSGQMRVGL
KRWHR

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	20	559	9.9e-165	0.982824427480916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	6.54e-132	53	662	47	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	3.56e-121	17	559	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
271199	LanC_SerThrkinase	6.53e-04	145	248	91	203	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT01986.1|GH127	1.59e-280	1	664	1	663
UJO16417.1|GH127	8.67e-278	1	662	1	680
ATZ54433.1|GH127	5.46e-277	1	662	1	661
QIW96336.1|GH127	6.81e-276	1	663	1	677
CCD50963.1|GH127	6.58e-274	1	657	1	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.18e-117	40	565	28	566	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.35e-111	40	565	28	566	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.16e-92	68	662	72	658	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.11e-92	68	662	72	658	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.12e-91	68	662	72	658	Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	1.62e-91	68	662	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CLCR_09723-t43_1-p1.