CAZyme Information: CLCR_09669-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_09669-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
719	LGRB01000008|CGC18	79447.31	6.9283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000008:2567417-2569722(+)

Full Sequence      

MADPERSILRHRGPKKDKTDTLTGGTETSSIADGVEDHITVVAPTGTESAATVAQPQGED
TGTIDFDIDEEFNLPPVPPNTPAEANLPVIRDYAVVTSSNGEESLVWHATAAAYLDGVEM
IEQEKADPVTLGTLLSDALTPINVITTVIYLALLCANAKSSKLISPATLFALAQINENLG
TITEGLWKTVITLARNRSPRPSLRLLGKNVPSVDVFVVCCGEPDDVVLDTVKAACKIDWP
TSKFRVIVADDGNSLNLRNKIQQMQGTYTNLHYYSRVKPAVGHHGYKAGNLNATLLDYVE
KTPAGYSEYCAIFDADMMPEPNILRMLVPHAIKDPNLAMVTAAQFHYNVPNDDPLNQGNT
TGTGAEDGNRDRVNAAWCPGSGFVLRTAAWHDIKGFPEFSITEDLITSWCLHGKGHKIAL
IPGVMQWGLQPDCLITHLKQRRRWWTGHIRDALRYNFTLNAEALSGASLIQRYAMFHHAC
RPYTMTITHTINTLLTLLCLWLGGPVIGGSDIRGLKQIVYCLAISRVIGLIGDVKSIFSG
SYLKVRRMIATGVWMGHHFSRDTLQTLLPQRLGGLRLGFGVSGVEDKPQIGVKERDVASR
PALLTRVWMVHQREGILWHLALFLVTVALVLYRVMGVFNTSTVNGQVILSNDFWTELVKS
VGFPGLALIDNVLYYLTPIFYMIDPPTMPERRETMKYDADTGLWKPREEYKKVLYTRAS

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	213	445	1.1e-20	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	9.97e-79	211	450	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.96e-33	190	457	33	293	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.41e-25	196	477	246	517	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	3.12e-18	215	404	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	4.14e-17	225	447	14	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS95146.1|GT2	8.66e-83	200	715	15	521
QGA21077.1|GT2	4.27e-82	200	715	264	771
CZS73870.1|GT2	6.63e-82	167	715	261	796
QYS95145.1|GT2	7.02e-82	139	715	140	713
SCB65333.1|GT2	1.05e-81	167	715	287	822

PDB Hits     

CLCR_09669-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58931|BCSA_PSEFS	1.27e-19	211	477	159	416	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q9WX61|BCSA3_KOMXY	1.74e-16	211	450	149	379	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q9SB75|CSLC5_ARATH	4.90e-16	207	447	223	462	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
sp|Q69L19|CSLC2_ORYSJ	1.13e-15	207	483	229	507	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC2 PE=2 SV=2
sp|P0CW87|ACSA1_KOMXY	1.33e-15	211	450	149	379	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000004

TMHMM  Annotations     

Start	End
485	507
615	637
661	683