CAZyme Information: CLCR_08661-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_08661-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: GDSL lipase/acylhydrolase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42081.17	6.2929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000009:3516690-3517914(-)

Full Sequence      

MRVPVVVVSLAVSLLAVSTSGSILPLPRQSKPWSAKQFSSLITFGDSYTDESRLGWFINH
NGTAPAPGTLLPESFATAGGGRTWPRYVVQYTGATVQGKWTPQMTLYNYAVSGAVCSNNI
TPRWFEAIDAPFPAVLEYEVPGFIADLPATKVNSTPAVPLYSPRPTAQDAAYALWIGTND
LGVWAFLTDSQIAGKVLADYTSCVYEVFDKLYASGGRHFVLMNTAPLDLAPLYANDSYHG
VGDNQYWPDKPTNHTAIASTMRQYTTSVNNVFKYQTPYEVKVANRYPGAHFALFDTHALI
TDIYNNPAQYLNGTGVAKGGESVWGFENHCNVNQTTCVKQANGTNSDGYLWFDELHPSEQ
TDRNIAREFVRVLNGTSKYATYI

Enzyme Prediction     

No EC number prediction in CLCR_08661-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	41	369	1.2e-64	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.45e-44	40	372	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.36e-12	170	369	130	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	5.28e-07	34	366	25	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	4.57e-06	38	373	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.002	41	369	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44554.1|CE16	1.44e-111	14	382	7	352
QRD84022.1|CE16	1.44e-111	14	382	7	352
BAE62044.1|CE16	1.44e-111	14	382	7	352
QMW32524.1|CE16	1.44e-111	14	382	7	352
UDD57534.1|CE16	1.44e-111	14	382	7	352

PDB Hits     

CLCR_08661-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	4.56e-93	13	382	9	344	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999726	CS pos: 21-22. Pr: 0.9642

TMHMM  Annotations     

Start	End
5	27