CAZyme Information: CLCR_08167-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_08167-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: alpha-L-rhamnosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683		74586.34	4.6153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000009:2897103-2899154(+)

Full Sequence      

MFALLVATVEVVQSQCWRDYPCSGPVDAAFPGPWDQNNYAPASRFVSPASSLIWPNLTSV
PYAEVQTISGNGSLVTYDFGKEVGGIVRFSYTSSDAGTLGIAFTESKKFIGYVSDSSNGL
FTGSDLWLNLTLTGQPGEYVMPDEVLRGGFRYMTLWLSTNSSTTSFSAQNITVELDFQPT
WSNLRAYQGYFHCSDELLNRIWYAGAYTLQTNAVPTDTGRQVPMLVWNWANNATLGPGYS
IIVDGAKRDRAVWPGDMGIAVPSAFVSTGDLESVRNALQVMYDYQNTTTGAFDESGPPLS
QKNSDTYHMWTMIGSYNYVLYTNDTAWLVALWTKYKHAMEYVVGKIDQSGLMNVTGTRDW
ARWQQGFHNTEANMILFQTLTTGSKLATWLGDSATAKDWSATVTALAKAINEHTYDATAN
AYRDNDTTTNLHPQDANSMALLFSVAAPAHVAGIASALVNNWTPIGPVTPELPYNISPFI
SSFELLGRLAVRDTARALQLLRTLWGWMVNNANSTESTLLEGFLANGSFAYRSDRGYAYD
ESYVSHAHGWSSGPTSALTHSVLGLDVRSPAGREWTLAPQTGDLAFAEGGFTTVLGRFSA
KWRLSEGGVLLTWDTPVDTSGRIVLPVCNMPVSARADGVQVVVQLNGEDNTVHVKPSAVS
AFGEYLGEIDVPGGEGRVWYPLE

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	74	625	1.4e-90	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.41e-12	189	455	4	247	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.64e-07	564	627	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	6.69e-273	4	626	12	643
QRD88907.1|GH78	7.71e-272	4	626	12	643
ATZ56650.1|GH78	5.63e-271	5	649	13	655
BAU45349.1|GH78|3.2.1.174	2.90e-270	16	626	25	638
QQK41592.1|GH78	2.54e-266	12	651	21	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.46e-12	61	612	183	693	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

CLCR_08167-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000463	0.999499	CS pos: 14-15. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in CLCR_08167-t43_1-p1.