CAZyme Information: CLCR_07314-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_07314-t43_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	LGRB01000010|CGC1	43108.41	6.1297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000010:297578-298714(+)

Full Sequence      

MPSPLIIEGLSGQEVSEKIDLLIHNLINIKDQTGHFLLKLPDGRVIDTKGWNDWEWTHGI
GLYGLYQYHALTSSPLALKVMNDWFRARLAEGTTKNINTMAVFLTLAYLYEETGERSFLP
WLDSWAEWAMNDLPRTTFGGMQHITYLEVNHNQLWDDTLMMTVMPLAKIGKLLNRPHYVE
EAKRQFLLHIQYLYDPQTGLFFHGWEFDGSATGGVGHNFARARWARGNSWLTIAIPDFIE
LLDLPPGDGLRLYLVSVLEAQCQALRRLQAADGTWRTLLDVSEEEGSYREASATAGFAYG
LLKSIRKRYISNQYTDVAMKAVKAVIQRVTTDGELLDVSFGTGMGRDLKHYIDIERTSMP
YGQAMAMMALVEFLRVYR

Enzyme Prediction     

No EC number prediction in CLCR_07314-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	375	1.7e-105	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.42e-105	24	377	6	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.07e-96	28	377	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76750.1|GH105	1.95e-208	6	377	7	378
UJO23795.1|GH105	7.94e-208	1	378	1	379
EGX50406.1|GH105	1.10e-203	4	377	5	380
SMR60657.1|GH105	1.45e-203	4	377	5	378
SMQ55448.1|GH105	2.92e-203	4	377	5	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	2.63e-175	8	375	2	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	1.35e-160	10	377	21	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.49e-156	10	377	22	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	8.89e-38	54	375	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	7.76e-14	155	335	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.04e-09	170	321	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.04e-09	170	321	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_07314-t43_1-p1.