CAZyme Information: CLCR_06697-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_06697-t43_1-p1
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		63922.30	8.3419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000010:3433991-3436356(+)

Full Sequence      

MPWSPTREFPQPIANIKSSRASRSMTNEMSYTLVDMLTWEGLGDLVNKFRKETLGLPILS
QAAATDMLHRLRIPYTYCWSPALIPKPKDWGPHITIAGFYFLSLASNYQPEPALAEFLAA
GPPPVYIGFGSIVVDDPNGMTELIFDAVRKTGQRALVSKGWGGLGGDDLGQPADVFMLGN
VPHDWLFQHVSCVVHHGGAGTTAAGIALGRPTELTADRLADAILQALKPETLTRAKELGD
LIKEEKGTDVGAASFHAQLDIENLRCALAPSRPAVWTVRTATSKGRTAAADIRLSAFAAT
VLSNEGLLDVNALTTHRPCEHPSDYGVMSAHALGPNPILSTAGGVASNMIHVPINIAKAW
CGLVYEPYKGAKADGLKGFGKGLGRGLGHFLFPQRDMVVGHGAAGVRVAYDAIKRKLGGD
STLSFILATRYVEGFEDVQTSTEEERVAVIARWNELGPPALRATTRRSKSRSRSSAPSGA
NTPATSASVSPGPSLSRLTSQTSTKSAKSENRLSRLFSRSSAARSTRSEVTLVRDAGAGA
GETSTSTSTSTPPPYSHANETGQKEGEGSAEAHEDISTILDVTSLDVISLYGHRTTVPFR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	21	253	3e-36	0.6020942408376964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.69e-36	9	257	129	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.19e-15	118	257	233	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ29661.1|GT1	8.96e-141	1	356	323	698
ATZ49754.1|GT1	6.88e-138	1	356	334	709
APA09867.1|GT1	9.25e-137	1	356	334	709
CCD33816.1|GT1	9.89e-137	1	356	334	709
UPK97528.1|GT1	4.86e-131	1	453	289	885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.22e-37	1	212	150	365	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	9.63e-37	1	212	170	385	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	4.30e-20	111	260	227	396	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.31e-18	17	269	132	347	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	5.68e-14	17	225	132	321	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	1.19e-63	1	259	330	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	5.16e-58	1	262	293	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|A1CYS1|ATG26_NEOFI	2.05e-41	1	260	1039	1329	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q4WID6|ATG26_ASPFU	6.58e-41	1	260	1030	1320	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|Q5B4C9|ATG26_EMENI	2.12e-40	1	260	1024	1314	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_06697-t43_1-p1.