CAZyme Information: CLCR_06695-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_06695-t43_1-p1
• CAZy Family: GH51
• CAZyme Description: putative mannosyl-oligosaccharide glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	LGRB01000010|CGC3	90054.46	5.2491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000010:2811256-2813640(+)

Full Sequence      

MLSCPRGVVALRSFLVCIATLLLFNFPPIHASNDTLLWGPYRPNLYFGVRPRLPNSLLTG
LLWANTDSYASTQQNFRYTCEQHEGMAGYGWEEYDARNGGRQVIHDTGNKIDLTIDFVKV
PGGQHGGSWAARIKGTPREDAPDNIVTTLVFYAAMEGLGELGFKDTDAEPDTVTLHGETG
DLGSFDIYFGDPSENLLPYKTHPSWDLKPLDKPVLSSVQVPSEAIWQAKNIVFASMKGEI
EDLVQQYGQENMPPPWQAFAIKHDPQAGNFHMVQRIFVGGFETDILFNSASGSPVTSETL
TQAIADSSKSFKAKFREVFKPLAPFTKSVYTDFSESMFSNLFGGIGYFYGDSLVDRSYAP
EYDEDNEGFWEETAAARARAEIVKDPPAELFTSVPSRPFFPRGFLWDEGFHLIPIAEWDL
DVTMDIVKSWFNLMDQDGWIAREQILGAEARSKVPVEFQVQYPHYANPPTLFLIIDTLMD
KSSHPAYASSRDRIMSELRHLYPLLKRQYYWFRRTQHGDIKSYDREAFSTKEAYRWRGRT
PQHILTSGLDDYPRPQPPHPGELHTDLISWVGMMSRTLLRLSTLLDETDDIPDFTTQHKA
LLRNIDDLHWSSEHKCYCDATIDDYEDSIHVCHKGYISIFPFMTGLLPPDHKHLPDILAL
IANDQELWSPYGIRSLSKSSPFYATDENYWRSPIWVNMNYLILKALLSTASAAHAPAKVK
TQAATLYSDLRKNLVDTVFHEWQRTGFAWEQYNPETGEGQRTQHFTGWTSLVVVIMRMPD
LAGEGGGGIKHGEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	563	777	3.1e-31	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	296	778	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.78e-116	36	254	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	5.22e-09	440	708	304	550	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	0.002	650	770	668	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	30	782	42	807
BCS02288.1|GH63	0.0	31	794	39	822
BCS13967.1|GH63	0.0	31	794	39	822
QGA12606.1|GH63	0.0	31	794	35	818
CAL00956.1|GH63	0.0	31	781	39	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.58e-162	32	776	11	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	8.97e-131	31	776	32	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4WVA_A	1.20e-06	659	774	317	416	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	9.68e-230	31	776	37	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.50e-161	32	776	41	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	6.01e-131	31	776	87	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.36e-124	23	776	74	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	3.48e-124	31	776	87	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000502	0.999491	CS pos: 31-32. Pr: 0.9734

TMHMM  Annotations     

Start	End
7	29