CAZyme Information: CLCR_05685-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_05685-t43_1-p1
• CAZy Family: GH43
• CAZyme Description: Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		67777.40	5.4392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000020:734408-736210(-)

Full Sequence      

MAIRLRRIVLLSTAACTLLFLFWRLQERFVDTTRESVTEETSSSSYRGRYGVGPGHLLNP
VSSYIPLPTTAQALPRIQHDFKAAAVGRAAGGKTRLARLETIKEAMVHSWRGYRENAWLQ
DELAPVTRGSRKTLGGWAVTLVDALDTLWLMGMTAEFDEAVAAVADIDFTTATQLPINVF
ETTIRYLGGLIGAYDVSGGRYPILLDKARELGDMLYEAFDTQNHMPVTKWSKIGPGIEAP
NAQTLIAELGTLSLEFTRLTQLTGDPRYYDAVQRVTDCLESQQNQTRFPGLFPHIVNARD
CYFFDGVSFSLGGSADSVYEYFPKEYQLLGGGAEQYRKLYDIAKGPIKSSILFRPMTPTN
EDILLAGMVKAYRPGHTKLIPQTQHLACFAGGMFALAARMFDTPEDMETAKKLVRGCIWA
YNQTAIGIMPEMLHAVPCSEEHPECPWDQQLWAEAMFELNTKDESPEDKLLPEDVRVRQK
SHRLRFSKGISAIADRQYALRPEALESIFVLYRITGDESLRDDAWRMFEAIMKQTRTAYG
FSSIEDVTVSESKKTDRMESFWMAETLKYMWLLFEDPTIVSLDEFVLNTEAHPFRLETAR

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	106	595	8.8e-159	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	105	596	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.97e-129	98	596	72	518	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.002	185	303	472	589	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX97511.1|GH47	9.82e-190	5	595	5	588
UJO18142.1|GH47	1.88e-189	59	593	63	597
USW52313.1|GH47	8.80e-187	61	593	74	604
QRD03835.1|GH47	6.08e-185	1	595	2	587
APA15806.1|GH47	1.05e-183	24	595	28	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	3.47e-73	98	598	10	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	3.65e-73	98	598	10	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	5.80e-73	98	593	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.72e-72	98	598	5	453	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	2.57e-72	98	598	88	536	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	5.99e-71	75	594	173	642	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	3.86e-70	98	598	249	697	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|D4AV26|MNS1B_ARTBC	2.01e-68	100	596	42	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.18e-67	98	598	98	539	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	6.58e-67	98	593	207	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999610	0.000419

TMHMM  Annotations     

There is no transmembrane helices in CLCR_05685-t43_1-p1.