CAZyme Information: CLCR_04600-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_04600-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		89706.91	8.3441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000011:201714-204181(+)

Full Sequence      

MSTPNSTLRQRGPKKENKPVVDGDKEDDETLKRALDELNRSVSNDWDYRLALGIITILAF
ATRFFGINHPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALVGWLVGYDGHFLF
DNIGESYITNNVPYLAFRGLPAFLGALTVVVVYLIMWESGYSLPACVLAAGLVLFDNSHV
GQTRLILLDATLVFFVSLSIYCYVRFYKERHDAFGRKWWKWLLLCGFCMSCVISTKYVGA
FTFFTIGCAVLLDLWDLLDVNRKGGALDLFTFGKHFVARAVGLVIIPFFFYLFWFQVHFA
ILTRSGPGDDFMTPEFQETLSDSMMHQASIDIQYYDHITLRHKDTKVYLHSHPDRYPLRY
DDGRISSQGQQVTGYPFNDTNNNWEILPSEPSPDPSAWAGKPVLNGEVVKLRHVVTNTIL
LTHDVASPYYPTNQEFTTVPLDIAAGERHNDTLFSIKMEQGKQGAPFRSMSGQFKLIHYP
TKVAMWTHTSPLPEWAFKQAEINGNKNAQQSTNIWYVEDIPSLPEDSPRRIKEAKKTKSL
PFYRKYIELQRAMFYHNNALTASHPYATQPYQWPFLLRGVSFWTQDSTKQQIYFLGNPIG
YWITSALLAVFAGILGADQLSLRRGIDALDRRTRSRLYNSTGFFFLCWAAHYFPFYLMGR
QLFLHHYLPAHLASCLVTGALVEFIFNVDPVLDDDVPPISATAKKDNKSMQKPHDKARKH
FQTANERLKGQSMLGTWIATGVVLCAVLYGFYFFFPLTYGWPGLTPAQVNARKWLGYDLH
FAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	54	299	6.4e-72	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	47	783	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
406576	PMT_4TMC	2.63e-78	544	775	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
396786	PMT	1.31e-77	54	303	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	1.12e-13	340	498	3	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.71e-10	330	389	2	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42948.1|GT39	0.0	2	783	3	771
SMR42986.1|GT39	0.0	1	783	1	779
SMR45157.1|GT39	0.0	1	783	1	779
SMY20320.1|GT39	0.0	1	783	1	779
SMQ46634.1|GT39	0.0	1	783	1	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	3.59e-103	49	778	50	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	3.71e-87	54	670	70	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	1.60e-246	7	783	4	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	4.12e-238	48	783	52	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.41e-237	48	775	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	1.67e-110	52	775	71	751	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|F1QF89|POMT1_DANRE	2.90e-108	42	774	8	709	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000060

TMHMM  Annotations     

Start	End
50	67
92	114
135	157
185	207
237	256
276	295
593	615
635	657
664	686
733	755