CAZyme Information: CLCR_04575-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_04575-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: putative beta-mannosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	LGRB01000011|CGC5	97265.07	5.7655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000011:1352061-1354743(+)

Full Sequence      

MGDISAAMVKPVPLEVTDLSEGWSFKQTDDIGGNSWSPVKKVPSTVHQDLIDNKKLEDPF
IGLNEIKAEWVGLKSWTYRTKLSPPSVPEGSKVVLAFDGLDTFAHVKLNNKTILLSDNMF
VPHRVDITEAIHTETSHELEIEFDSAFLKAREIKDQHPEHKFICFNGDPARLAVRKAQYH
WGWDWGPVLMCAGIWRPVRLEVYTVRVADLRTDIDISDDHKLATIQASTEIEGLEDRNLH
VQAKFTVSLGDREISSSKVEVTADGKATAQLKVPDPELWWPNGYGKQPLYTVSVAIAADE
TVLHTESRRVGLRRVQLVQEPDRHGKSFYFRINDVDVFCGGSCWVPTDSFLTNVTPEKYR
AWIELMVPANQKMIRVWGGGIYEHDAFYDACDELGIMVWQDYMFGCGNYPCFPAMLKSIE
AEAVANVRRIRHHPCLVILAGNNEDYQVQESAHLTYDYEDKNEEHWLQSDFPARYIYESL
LPRVSAAEAPDIPYHPGSPWGDGKISSDPTVGDMHQWNVWHGTQEKYQIFDSLGGRFNSE
FGMEAFPHIATIKSFVEKEEDLYPQSHVLDFHNKADGHERRIATYLVENVRTATELEAYI
HLTQLVQCEALMFGYRGWRKQWGDERHCGGALVWQLNDCWPVTSWSIVDYYLRRKPAYYA
MARVLAPVAVGIRRSHHDWSVTHAREPQSQEWELWVVSSRQTEMTADVEVKFVSVRTGRE
IKDKIVKKGVKVRRNGTTDVLKGVIDNVHEEPHVLAARIWIDGELVARDTDWPQPLKYLQ
FPGRNVKVEIVGDEMHVSAERPVKCLVFEEREGCHLSDSAIDLVPNDKQIIRVRGLKSGA
PPLDWTFLGAGEQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	15	726	1.2e-97	0.6715425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.36e-78	15	670	11	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	5.63e-15	205	313	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	9.94e-14	690	778	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236657	PRK10150	3.10e-10	8	331	1	295	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16892.1|GH2	0.0	19	849	10	843
BCS05337.1|GH2	0.0	19	849	10	843
ABF50864.1|GH2|3.2.1.25	0.0	19	849	9	842
QKX54479.1|GH2	0.0	19	850	9	845
UDD65874.1|GH2	0.0	19	849	9	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	8.42e-141	14	834	24	811	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.66e-123	15	839	7	824	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.74e-123	15	839	9	826	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.78e-123	15	839	9	826	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.66e-123	15	839	7	824	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NW36|MANBB_ASPFN	0.0	19	849	9	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	14	849	4	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	0.0	14	849	4	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	0.0	19	849	9	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	0.0	19	849	9	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_04575-t43_1-p1.