CAZyme Information: CLCR_04087-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_04087-t43_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	LGRB01000012|CGC6	47424.09	8.3404

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000012:285447-286919(-)

Full Sequence      

MRLAWLSSRQVQRRLLISLIVSAFTFWCLLPTRKHELRPANLEERYPLLWRHVHACNGSG
GAWYIPPNWLSSAGVQPENIVDAALLASQVTSASRHRHIEHSSIPLLLHQTWKNRRIDTW
SDLLRLSVEKWLRYVVSDDMAYFFWEDDGVLQMLDEFEPDFVERFRSLPSNVERADVFRI
LVLKWFGGIYADVDTQPLRRPSSWISPSDLAPWTDPVTNSKFSSDNAVSIVLGIEADCPP
DKDDYWRMGYSYPVQLTQWALASSSGHPILLHFMDTLQRRLNHVANRYRGDLTDTDAAKE
LRQIGPLSLTGPVAITVAAMTWLEEQAGLRWNALTGLFDGGRSKLVDDVLILPITGFSPG
RRKYGNMGSKPVTDPSARVWHRAQGSWRSFDVKVEYGKFCRSVFGLCKDWSKQPA

Enzyme Prediction     

No EC number prediction in CLCR_04087-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.60e-17	101	270	79	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.85e-11	121	206	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93027.1|GT32	2.97e-171	13	414	7	408
BCS05686.1|GT32	2.97e-171	13	414	7	408
QKX57092.1|GT32	1.05e-169	9	412	8	414
CAK38082.1|GT32	7.97e-169	13	414	7	408
QGA12609.1|GT32	8.20e-161	9	412	9	420

PDB Hits     

CLCR_04087-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.03e-28	101	388	139	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.91e-26	99	388	111	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.70e-18	104	388	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.98e-16	101	358	127	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	1.94e-11	100	211	53	168	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CLCR_04087-t43_1-p1.