CAZyme Information: CLCR_04073-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_04073-t43_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	LGRB01000012|CGC6	51910.44	6.2390

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000012:1343254-1344759(+)

Full Sequence      

MHFPCSASLLTILQLVILIRSSAAQSSYWLANKPARGKIAFQDPTYPVFRNVKDYGAVGD
GSRDDSDAINRAISAPGSLNTITSRLDGRCGGGNASYGSFCQSSTITPALVYFPPGIYNV
SKPLIMYYATQMVGDAVNPPTIRVASNFTNIIGLAVFDADIYIPSGSGNEWYANQNNFFR
QMRNFIIDMTNAPLKTAGIHWQVAQATSMQNIVINMVSKDVVNNQQQGIYMENGSGGFFS
DMVITGGAIGAYLGNQQFTTRKIRFDGCATAIKMNFDWLWLFTQISITNSDIGIDMTSGG
FSNLAVGSLVVIDSTISATQGIITPYAPGYSSPQAAGTMVLEKVDFTGSEIAISAAGGTQ
ARTVLAGQQFVDLWAQGNAWTTAGAALNGQYFNGTTCTYQNASQTAYTAQETTIQRALAP
IPRPSVLTDSNGQYIYRVKPQYENLDWNNNFLSAKANGLVGDGSAGAYFFTPHPSPLAPP
WCP

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	22	465	6.1e-113	0.522972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	5.69e-75	49	295	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC19167.1|GH55	7.89e-121	22	463	2	391
AEO58209.1|GH55	3.66e-117	25	463	30	421
ANH56453.1|GH55	1.07e-116	23	464	40	429
QLI64786.1|GH55	2.17e-116	23	463	40	429
ACS66685.1|GH55|3.2.1.58	1.77e-115	24	463	30	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	3.06e-117	24	463	2	395	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.51e-96	21	463	19	412	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	3.95e-98	26	463	41	523	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.32e-69	21	463	41	435	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.13e-07	43	329	58	342	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999625	CS pos: 24-25. Pr: 0.9617

TMHMM  Annotations     

There is no transmembrane helices in CLCR_04073-t43_1-p1.