CAZyme Information: CLCR_04005-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_04005-t43_1-p1
• CAZy Family: GH2
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	LGRB01000012|CGC3	63008.95	6.6596

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000012:1299407-1301183(+)

Full Sequence      

MSSTLPDRFDFIVVGAGPAGAVLASRLARSNRKPSVLLVEAGGKNDSKAVRADAERWLHR
MVPGMNWGYQTAPVKGFDGRVISYDRGKGLGGSSAINFSVWTVGPKGDYDELARLVGDEE
WKWSNVQERYKRLETYHGDAGDDVDSVRHYRDADPKNHGYDGPIHVGFPKVWEPQGKELM
DIWYANGAKHNLDHNSGDPIGLALCISTAYKGVRSTSADALIDAPSNLHILVDTQVARVV
FEGTKASGIRTLDGRTIHADKEVILCAGSLDTPRILLHSGIGPAEQLKAFNIPVVKANDN
VGAHLKDHHHITIPVIRANPKDERTKFYKSKELQAAARALWEKDGNGPLSEYATTLGIAY
EKIDHIAELPEFQALPKEEQDHLLEPTVPHYEYILNGPWLPHFIDPENAETGVTVFVFVL
NQKSSGSVRLQSSDPAQPLIFDPNWFSHPFDRRVAVEATRKTLKIMNSPQFHNGTVTIDG
PKSESDEDILAYWRGRSESTWHMMGTARMGKDESRAVVDRNFKVFGVERLRVADMSVIPI
VSNNHTQTTAYLTGLTAADKLVREYGLDA

Enzyme Prediction     

No EC number prediction in CLCR_04005-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	562	3e-153	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.35e-96	9	564	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.97e-81	8	560	5	530	choline dehydrogenase; Validated
274888	Rv0697	2.98e-51	10	558	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.41e-41	423	557	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.98e-31	9	564	56	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33321.1|AA3_2	4.48e-183	10	567	6	563
QMW45359.1|AA3_2	6.34e-183	10	567	6	563
UDD61192.1|AA3_2	6.34e-183	10	567	6	563
BCS23517.1|AA3_2	2.70e-181	9	567	5	563
QRD84914.1|AA3_2	6.62e-181	10	564	6	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	1.08e-64	9	559	3	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	1.47e-64	9	559	2	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4H7U_A	3.70e-54	9	565	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	1.95e-49	7	565	5	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.68e-49	7	565	5	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|V5NC32|PDH1_AGAXA	1.05e-56	8	551	40	585	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|B5ZUG2|BETA_RHILW	1.09e-56	10	562	4	526	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=betA PE=3 SV=1
sp|Q2KB43|BETA_RHIEC	1.51e-56	10	562	4	526	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	2.44e-56	9	559	41	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.87e-56	9	565	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999697	0.000327

TMHMM  Annotations     

There is no transmembrane helices in CLCR_04005-t43_1-p1.