CAZyme Information: CLCR_03877-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_03877-t43_1-p1
• CAZy Family: GH17
• CAZyme Description: FAD binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	LGRB01000012|CGC7	92204.85	6.6281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000012:1132135-1134570(-)

Full Sequence      

MQTIPEFTGPQFPFSTDPYAAKAYADVHYTLNLDRDMPPALIAFPRHEKDVRTAIRYARQ
NGYRISVFTGGHYYDGGVHAPTTPDVQLNLTLTYAGPKHIGLTTVEQWVPYRTKNQLWVG
VSQSIGDINRILREDGRFLPHGQCSDVQLVGHGQRGGGGQLGRSFGLLGDRIRAIRILNH
TGESEMITTCDPKAHAILGGIAGSFGVVTHYSFQAFADEDFDFPDTNSRPHGFKGVWRYN
QPALKLLLNEVATMADDSSLPPNFDLSVNVFSASFPMLRLIPKLKDNPHNPIESINGEQP
GHTNSTWPACIVVFAQWVPMSREDKYTAQVDAWFQKFRDLTTVKNCCIHTEELVQPMSAM
TGEWLFRGSREFDLPYIRRMYLTKSRAMAQSGWVETTALQIDRILDTSRASSLSQSCYLA
AKIQCLGGNLTQPSDEQFRGESCEKRDWTVSQTLDCFHPADERGEATANEWQSWNDLVFC
TLGHALRRLDKRVVWTLSTDWQMDKTWSYYRQVVQTKYDEHAMRKHQTKYKPEKRAKQRA
KGQTKLPAIYPKQITNSEQAEHQDQVTSPHQAMNQGSATSQDANLLSDQPTLQKRPALPK
QPILQKRPRLPKQPARRAQPAVQEQPTSQEQPKLHEEAVYPEQLVFEKPAINPGQAMISE
PAILQEAAMFQHFATFQDPAMFQDYSIFQDSAMPREFSMYQQPATFHDCDMSPDLTLAQE
HTMEQDLIQDLTANQTLTMSQDPIMNQQHAIIPELAINTWPSMSSQLSNYQKQMDGYYKG
CWGFVPDPYSYYTAWQHPQNQPWCAMMASES

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	36	264	2.3e-28	0.4737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	6.46e-10	39	141	1	90	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.79e-07	10	214	7	202	FAD/FMN-containing dehydrogenase [Energy production and conversion].
185628	PTZ00449	4.41e-07	498	653	461	633	104 kDa microneme/rhoptry antigen; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS96687.1|GH31	3.34e-61	1	510	1	490
UKZ49297.1|GH31	1.21e-60	1	510	1	490
UKZ75824.1|GH31	2.30e-60	1	510	1	490
UPK91582.1|GH31	4.01e-55	5	510	3	487
UPK94696.1|AA7	1.52e-10	32	217	56	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IPI_A	7.65e-09	42	214	58	228	Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_B Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_C Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_D Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus]
6YJO_A	1.73e-08	32	247	62	260	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
4DNS_A	1.17e-07	34	214	50	223	Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon],4DNS_B Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon]
4PVK_A	3.56e-07	36	214	50	221	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]
4PVH_A	4.69e-07	36	214	50	221	Phl p 4 N158H variant, a glucose dehydrogenase [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54H55|Y8969_DICDI	2.96e-10	26	229	35	228	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|Q9FZC6|FOX3_ARATH	2.28e-08	42	214	80	243	Berberine bridge enzyme-like 5 OS=Arabidopsis thaliana OX=3702 GN=FOX3 PE=3 SV=1
sp|Q9FZC5|FOX2_ARATH	3.03e-08	42	214	80	243	Berberine bridge enzyme-like 4 OS=Arabidopsis thaliana OX=3702 GN=FOX2 PE=2 SV=1
sp|Q0PCD7|AKNOX_STRGJ	4.08e-08	42	214	82	252	Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus OX=33899 GN=aknOx PE=1 SV=1
sp|L0E159|MALF_MALAU	1.30e-07	39	218	122	303	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_03877-t43_1-p1.