CAZyme Information: CLCR_03392-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_03392-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: 1,3-beta-glucanosyltransferase gel4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		56392.49	3.7035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000013:224117-225952(+)

Full Sequence      

MKSFSAAATAVAGAALLIRSAYADVDPIVIKQGYQLTCSTEDYLGNGTTAGNDDNYIDPL
ADPSTCQRDIPYLVQLGTNTIRTYAIDPTQNHDECMSMLADAGIYVISDLSSPGNSIIRD
SPTWNDDLYARYTAVIDNLAKYSNTLGFFAGNEVSNNNTNTDASAFVKAAVRDMKAYIKQ
QDYRPIGVGYATNDDAEIRENLANYFDCGNPEDAIDFWGYNIYSWCGDSSYTESGFDQRT
AEFESYNVPVFFAEYGCNTVQPREFTEVQALYGPQMTPVWSGGIVYMYFQEVNDYGLVSV
DGNSVSTLADFSALSSQIAKISPTGVNSASYSPTNTAGAACPSVNNDWQASSSLPPTPNQ
ELCECMFNALTCRPNNVDSEDVGELFGVVCGLADGVCDGITANATTGDYGAYGMCNPEQQ
LGWALNTYYEQQAAQGNGASACDFGGSATTASPTAPTGNCASLISQAGSAGTGTVTSAPS
GTGGSGSGSGSGSGSGSGSGSSGSSSPNAGVAGFSASSQFGFLSVAAALTVAFVSGAGMI
LL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	35	321	4.1e-126	0.9262820512820513
CBM43	375	460	1.3e-16	0.9156626506024096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.51e-152	20	322	4	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.54e-25	370	449	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	6.13e-14	370	462	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29359.1|CBM43|GH72	1.81e-211	1	480	1	494
UJO23972.1|CBM43|GH72	1.81e-211	1	480	1	494
BCR83038.1|CBM43|GH72	2.16e-210	11	475	7	480
SMR63749.1|CBM43|GH72	7.36e-207	1	480	1	491
SMQ55427.1|CBM43|GH72	7.36e-207	1	480	1	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.34e-123	34	429	59	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.77e-123	34	429	59	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.77e-123	34	429	59	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	9.27e-204	3	479	5	501	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	2.82e-178	41	470	64	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	2.82e-178	41	470	64	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	2.82e-177	41	480	41	481	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	3.12e-177	41	480	41	481	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999730	CS pos: 23-24. Pr: 0.9759

TMHMM  Annotations     

Start	End
519	541