CAZyme Information: CLCR_03339-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_03339-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: Alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	LGRB01000013|CGC4	64454.31	5.4891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000013:476009-478121(+)

Full Sequence      

MGLYTTLPDELAEVDIIIVGGGTAGCVIASRLADTDPQCAILVIEGGPNNLDLPAVAHPA
LYRGNFMPGSKTIQPYLPRKEEHLSGRTAIVFAASVLGGGSSVNAAMYNRPQRDDLDSWN
TEGWSADELLPSLTKFETYHGRGDAACHGASGPIKVSSGTYTSNAMADDFVAAMNKTGFP
EVRDLQDLVSANGVSRTYRYVSPDDGRRQNAATAYLHPRLRDGHHPNLHVLVESQVVRVL
FDQDKRATAVEYRPNPNIRTEATRDLRRTVKARKLVVISAGTHSTPSILERSGIGSREVL
DRAAVPVLCDLPGVGRNYQDHQMTVYTYKSSMRAEDTTESIIDGTRDVAQLLGNNDKFLS
WNGVDASAKIRPTESDVDSMGSGFREVWERDFKNAPNRPLGLIFSVAGGRMPKWEMQHIT
GPDLEDPLDFETGFLSDRDDIDLTTQVWLYKTQRQVARRMRFYRGETHLHPRFPGRSNAD
SLAEPASDEEAGSEIRYSPEDDEAIRQWVREHIGTAFHSLGTCKMAPVEELGVVDKDLNV
HGVHMLKVADLSIVPENVSGNTMSTALMIGEKAADIIIQDLGLACRG

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	407	8.7e-162	0.6627118644067796

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.86e-75	12	584	6	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.30e-73	13	577	5	531	choline dehydrogenase; Validated
366272	GMC_oxred_N	4.83e-31	86	321	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.89e-25	418	573	8	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.44e-12	15	323	57	329	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX90875.1|AA3_3	9.63e-219	1	581	1	603
UPL02707.1|AA3_3	1.35e-207	1	583	1	604
QKX58265.1|AA3_3	7.47e-207	1	584	1	604
UPK91723.1|AA3_3	6.48e-205	1	582	1	601
UPK92594.1|AA3_3	7.74e-205	1	583	1	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3O_A	1.25e-128	13	586	6	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3G_A	3.50e-128	13	586	6	629	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	5.67e-116	7	582	3	637	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
3LJP_A	5.45e-48	13	577	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	7.50e-48	13	577	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	7.10e-127	7	582	3	637	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	2.06e-119	7	582	3	638	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	2.91e-115	7	582	3	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|C4R702|ALOX2_KOMPG	2.91e-115	7	582	3	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2QY27|ALOX1_KOMPC	2.91e-115	7	582	3	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999118	0.000937

TMHMM  Annotations     

There is no transmembrane helices in CLCR_03339-t43_1-p1.