CAZyme Information: CLCR_03294-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_03294-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: Glycosyl transferase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		104105.20	6.1805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000013:392583-395424(-)

Full Sequence      

MTSTFDLSMIPSSPGTPDSAGELRPTSASSARARPLSSRNNPNRRTMLYPQGDFRNSSMP
DLRELKTDMMCNWLHQQQIERMWTTNSIEEGVFLKKAKDHYKCAPEDLSSRPDGVYDAVR
RLNVKCAMTVNTGVVKLFLQDETLTHMPLDSGLRLQILPTINALPDCQKHQFAAFVRTNN
ILVVWDDDPNHILKRVQSIEDQLISMIWKEEFDDDASTPPALSAVPSTLNLSPNGNEASS
QDHERPLAPRRIVLVQPILTAFTLILLIAAIGSGWREIAIELKVDHNWTRLAFIAVVPFQ
CWLALFFMQSVAGCCAQIIGPISQMNANTKFYSGMPPPRLPTDGSCVLPHVTIQCPVYKE
GLWSVIDPTIKSIKDAISTYEMQGGTANIFINDDGMQIISAEEAQERRDYYDEHNIGWVA
RPKHNPKPNGEGEQAFVRAGKFKKASNMNYALNVSARVEDKLSANIQPTDGTWTVDQERT
TYRAALAEIIHEDEGRTQAAGNIRVGDYILLIDSDTRVPQDCFLSAVSEMEASPEVAIIQ
FASGVMNVTDSWFEKGITFFTNLVYTAIRYAVSNGDVAPFVGHNAFLRWTAVQDVAYVYA
DINDGVVKEKYWSEATVSEDFDMALRLQTQGYILRLAAYAGQGFKEGVSLTVYDELARWE
KYAYGCSELIFHPFREWVTKGPFTPLFRNFVRSNMPLPSKITIMAYIGTYYAIGSAWILT
LLNYCIVGWFNGHLDHYYIDSFKIYFAIIIVFTALGNLALAIMRYRVEEKTLGSALWENL
RWIPLLTVFLGGISLHVSQAILSHLFSIDMSWGATSKEATDTSFFAEVPTILRKFRFTFI
FCLVVSVGMVIVAGVGPLGQMVPYDWQIGWFTAIWPLATVVGESLLISLPGVSSSCSSCV
YTSRGNYTSRGGVRSVCDRKGVKPMIQRNN

Enzyme Prediction     

No EC number prediction in CLCR_03294-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	508	729	1.6e-53	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.17e-49	508	730	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	7.65e-12	356	620	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	3.43e-11	506	836	138	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	9.88e-07	349	642	1	222	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
215224	PLN02400	4.70e-06	608	878	772	1027	cellulose synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO15800.1|GT0	0.0	27	881	31	869
USW53192.1|GT0	0.0	48	887	53	875
SMY19115.1|GT0	0.0	44	887	49	870
SMQ45410.1|GT0	0.0	44	887	49	870
SMR43958.1|GT0	0.0	44	887	49	887

PDB Hits     

CLCR_03294-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

CLCR_03294-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
253	275
288	310
708	730
743	765
780	802
837	859
874	896