CAZyme Information: CLCR_03021-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_03021-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: Mannosyl phosphorylinositol ceramide synthase CSH1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		40394.02	9.6153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000003:467424-468473(-)

Full Sequence      

MRRSLLIFLLFAVVVLTFLLHSVSTLLALLIEDASRDAIHRSELPAPNSTLLETRPQLIP
KIIHQTYINESIPAHWVPAQQSCIDLHPDYEYKLWTDEKSHDFIAQEYPWFLSTFVGYRH
NIQRADAIRYFVLAHYGGVYLDLDDGCKRRLDPLLSYNAFVRRTVPTGISNDVMGAIPQH
PFFLRVMESLPGANRSWILPYITIMASTGPLFLSVIWKKWMGEHAHLNPDTWVGRVRVLM
PDEYNQHAWSFFETYKGSSWHGKDARLIFWMGKNWLLLTVLGFVLVLTVGFLVWFVYSRL
LMWSARRRGSPRMAALRFTGGAKMPLWRMWAGGLGINKQTYEMVAQHDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	78	156	1.3e-22	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.10e-72	57	295	80	315	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.66e-26	73	160	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS66595.1|GT32	6.20e-155	1	311	1	307
QSS73535.1|GT32	1.44e-153	1	311	1	307
EAA57874.1|GT32	8.36e-152	1	308	1	303
AAP47108.1|GT32	8.36e-152	1	308	1	303
BCS14035.1|GT32	1.36e-151	1	348	1	359

PDB Hits     

CLCR_03021-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.48e-101	1	284	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.88e-99	1	284	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.79e-85	48	306	46	297	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.31e-83	31	301	50	319	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	6.50e-54	59	309	64	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.331002	0.668991	CS pos: 27-28. Pr: 0.2815

TMHMM  Annotations     

Start	End
7	29
275	297