CAZyme Information: CLCR_02981-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02981-t43_1-p1
• CAZy Family: GH152
• CAZyme Description: glycosyltransferase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		42118.28	5.7796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000003:33562-34797(-)

Full Sequence      

MNSLPSQPNRITILAFVSFIGFLFLLVVWHSSSSNFGVIFQHSSSSRSGISSSRQRSLQS
IQNATLGFERILAINLPERTDHRDGLILAAAVSNLHIERVDGVHGDTILDKVLPPDHPEH
IDPARLGSWRAHMNAISRVVENNWTSALILEDDVDWDIRLSSLLTDFALASDTVLSRHDS
AALKFRGLSFSHTPVTSPYGDGWDVLWLGHCGMEIADSSSTVIQENDETVPEVRFLLSWD
RNEVSPLADYPPHTRLVGKQHEGVCSLAYAVSQAGARGLLNSLGLKRVDNAFDLMLREWC
EGIHEDHSHRCVGVLPQLFDHYRPIGPSEIDSDISAPNGGYRSQPFTQNIRWSVRLNMDK
LLRGETDYIDQWPDSKV

Enzyme Prediction     

No EC number prediction in CLCR_02981-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	69	290	1.1e-25	0.9558011049723757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.43e-19	70	157	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	6.84e-06	67	302	1	194	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI69289.1|GT25	1.40e-96	57	375	93	439
AEO68754.1|GT25	1.24e-93	40	376	27	394
AEO55058.1|GT25	3.47e-86	58	374	52	397
AEO67124.1|GT25	5.81e-84	61	374	4	348
ATY62278.1|GT25	5.83e-82	58	372	59	399

PDB Hits     

CLCR_02981-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

CLCR_02981-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000001

TMHMM  Annotations     

Start	End
13	30