CAZyme Information: CLCR_02928-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02928-t43_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: glycosyltransferase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		44322.79	5.1080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000003:207867-209311(-)

Full Sequence      

MIQAFRPHSVIGSLSRLSTTQPSRVSVVAFASLMGFLLLLIGYHNSSTYVTTWSSAVSAS
ASDRGTISPARQKSLDAIQNTTLGFEKILAINLPERTDYRDGLTLAGAVSNIQVEFIDGV
HGDTVLDKVLPPKHVDNPEAALRGSWRAHVNALRSVVEHNWTTALIFEADVDWDVRVRDV
LTNVALGSEALLSLPARGVQDQRFQLSRLSFPAAVAPPLSPYGDGWDLLWLGHCGMQIRG
GSNVVVIEDEDTVPEARFVRTWDSTERSPLEEYPAHSRIVFHTDDCVCSIGYAVTQSGAR
QLLNSLGLHRLNAPVDIMLREWCGGREGDDPHVCLGTLPTVFASHRPAGSTAGDSDMGTP
ADGFRDRGFTQNIRWSVRMNMDKIVRGDTDYEDQFPDTVNELVD

Enzyme Prediction     

No EC number prediction in CLCR_02928-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	86	318	1.6e-23	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.94e-15	87	174	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68754.1|GT25	3.85e-85	21	395	5	390
AEO67124.1|GT25	6.19e-82	78	397	4	348
AEO55058.1|GT25	1.31e-81	78	397	55	397
QLI69289.1|GT25	4.60e-81	71	398	90	439
ATY62278.1|GT25	1.54e-80	12	395	9	399

PDB Hits     

CLCR_02928-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

CLCR_02928-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000014

TMHMM  Annotations     

Start	End
25	44