CAZyme Information: CLCR_02866-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02866-t43_1-p1
• CAZy Family: GH130
• CAZyme Description: WSC domain containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	LGRB01000003|CGC3	58372.40	4.4859

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000003:1228571-1230316(-)

Full Sequence      

MRRTNNLGLLALGLVSSIAGATAGLTWPSAYDDLEDLVYLTNGYNARGFPVILQPCTIAK
EPGHSIAAGFVRTAFHDMAPFDVATGVGGTDASIGFELDSSIYPTNTGLAFNNTMHFYSQ
FFNSRTSMADLVNVGLYMAVRACGGPIVPVRAGRVDATGPGPVGVPEPTDPMPKMIGIFR
RMGFSPEEMVFVTACGHSLGGVHSAEHPDIVPPNSTPLGVQDLDSTNATFDNSVVTEFLD
GTTKNPLVVGANPAAYSDGRIFSLNNRQTVSALADPYAFANTCSGIFQKMVNTVPRTVEL
SDIITPYELKPTNLQLNVAADGQNLEFSGELRIHTNDLPSSSIASVQLIYKDRTGASDSA
YTISATVAGDANGFDDTFTFYSFASTIPASTSISTFTVLVTLTSGGTQTFDNYGQGYAIS
DKIFAQTSYSSLSAVDGSGNQQLTVFAAARTGEACEPVNLSMELIKPITYNDLPTVSVVP
QPMTSICAGQYYTFYSATFSVPAPGVNFTHYDVSATSDGAVVADSFKGLKSLPATAAAAP
SCGGAWAKRAVNFSA

Enzyme Prediction     

No EC number prediction in CLCR_02866-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	64	248	4.4e-27	0.6901960784313725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	2.72e-110	27	292	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	4.44e-25	65	292	16	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.60e-20	65	203	14	155	Peroxidase.
173825	ascorbate_peroxidase	1.60e-16	70	246	33	201	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	8.60e-14	71	292	42	254	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	5.61e-118	9	527	6	522
QBZ57066.1|AA0	6.30e-117	9	535	11	534
VBB76056.1|AA0	2.20e-111	1	502	1	504
QRV94524.1|AA2	3.83e-97	7	537	2	533
QRV79935.1|AA2	1.80e-94	7	537	2	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W23_A	2.88e-07	71	250	42	210	Structure of mutant W169Y of Pleurotus eryngii versatile peroxidase (VP) [Pleurotus eryngii]
5FNB_A	3.10e-07	71	239	42	202	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]
3FM6_A	4.12e-07	71	250	42	210	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
2VKA_A	5.14e-07	71	250	42	210	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
5FNE_A	5.48e-07	71	250	42	210	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Triple Mutant E37k, H39r & G330r [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.04e-117	7	537	3	513	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	1.15e-11	42	200	91	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|A4R606|CCPR2_MAGO7	7.54e-08	71	205	34	171	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1
sp|Q6ZJJ1|APX4_ORYSJ	2.25e-07	71	258	35	211	Probable L-ascorbate peroxidase 4, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX4 PE=2 SV=1
sp|O94753|VPL2_PLEER	1.80e-06	7	250	6	240	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000402	0.999554	CS pos: 23-24. Pr: 0.8039

TMHMM  Annotations     

Start	End
7	29