CAZyme Information: CLCR_02779-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02779-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: Versicolorin B synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		68613.74	4.4137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000003:1369839-1372208(-)

Full Sequence      

MLLTLGSGTFARTNLLVTVIVALSACIHASPFFRRSDHPSSGKKSADFIIIGGGTAGLTV
AARLVEADFTVLVLEAGGFPDSYGLPWDSPALTGEMTDTPVDWNFTSLAIPGLNGRTVAQ
NQGFCLGGTSSINGLTYGRGSRSIYDNWEAIGNPGWGWDDVQEYFERTWKLVPSPNDAHY
RTYDPSLYDPNAGPGELGYTNFNPPSIDAFVESLPSIGIPISLDLNSGNNIGGKHELSTL
DPLSQTRISSYTAFWHTVVGRSNFEAITFAVVEKILFRSADGKEGSSQPVAYGVEYSTTI
NGQKRKQTAYADKEVILSAGTIQTPKVLMLSGIGPRQTLQGLEIPIVYENEWVGKNLRDS
PSFSMIVKTTDEASTNKFQHNMDAIQAAMAEKASDPTSSSNPLNAIDGNSGPAYSFAKLS
TSDLEDTGAAYLIANQSDQAHYEVILWTSLYPLPDNVPTLNNYYDFSNYTQESYVSLASY
LLVPGTGGNVTINSRDVSAPPLINLPFHELDADLNIQILSLKRLRTLISQSAFAQYTLGP
AYGEIVPGPDVQTDEDIANFIRETSVSAAHQAGTAAMRPLDDEGVVSPSLEVYGVQGLRV
VDASVMPLFVDQHPTAAIYMIAEKAAQMIKDKYGAE

Enzyme Prediction     

No EC number prediction in CLCR_02779-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	45	631	3e-150	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.78e-89	43	630	5	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.77e-82	44	632	4	534	choline dehydrogenase; Validated
274888	Rv0697	1.32e-42	46	629	1	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.21e-34	488	625	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.73e-32	114	361	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67839.1|AA3_2	1.29e-110	47	634	40	611
CCT67729.1|AA3_2	1.45e-110	17	633	5	603
QGI81035.1|AA3_2	1.45e-110	17	633	5	603
QSS49367.1|AA3_2	2.56e-110	47	633	40	610
QGI63763.1|AA3_2	2.88e-110	17	633	5	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.93e-58	48	633	8	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.97e-56	47	630	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4H7U_A	2.78e-56	9	633	6	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	1.01e-55	47	630	4	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	7.52e-55	8	629	2	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	9.32e-86	42	630	37	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q5AUN2|XPTC_EMENI	1.96e-68	22	634	18	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	4.20e-68	47	629	37	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	3.07e-67	42	626	47	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q12062|AFLK_ASPPU	5.67e-66	44	629	73	640	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.277140	0.722829	CS pos: 29-30. Pr: 0.6171

TMHMM  Annotations     

There is no transmembrane helices in CLCR_02779-t43_1-p1.