CAZyme Information: CLCR_02533-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02533-t43_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		36399.84	8.0411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000014:43402-44413(-)

Full Sequence      

MSRLEITRCGIHGFHETIGIDTDEIRVYWALRSDAESASQVAYRVIISTQRDHLEQRSSS
QDGLIFDSGRVASSAQRNIICRPEHGFESTAMHFWQVMVWDNDGTMTVSSIHEFYTSYPR
CSRRLPPYSPNQVYMPHTSLIFRTWFEDAPNRWKAIWIGDGGDKPIYLRKSIVHGAQKPS
RVIVFASGLGHFNLTINGKPASNHVLDPGWTDYHRTVQFVGYDVTSSWDAGENVVGAHVG
NGFYAGDQGDRFFWPKYKNNTYIRFGNELCFFAEIHVHYDDGRHEVIISDHDACQCLRFR
RPRPTALSRRLGLPRVR

Enzyme Prediction     

No EC number prediction in CLCR_02533-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400715	Bac_rhamnosid_N	7.61e-46	178	292	2	109	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91716.1|GH78	5.62e-149	4	290	1	281
UDD64414.1|GH78	5.62e-149	4	290	1	281
EAA67087.1|GH78	5.06e-146	4	290	1	283
QMW35313.1|GH78	1.32e-144	4	290	1	281
QMW47375.1|GH78	1.32e-144	4	290	1	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.86e-18	18	290	44	284	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.36e-14	177	292	314	420	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPL4|PLH28_FORAG	6.82e-14	18	244	44	262	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
sp|Q82PP4|RHA78_STRAW	6.97e-14	177	292	314	420	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	2.28e-12	13	290	43	290	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CLCR_02533-t43_1-p1.