CAZyme Information: CLCR_02402-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_02402-t43_1-p1
• CAZy Family: GH128
• CAZyme Description: glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	LGRB01000014|CGC4	54894.94	6.3969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000014:1286320-1287877(-)

Full Sequence      

MASGYLKVEGDKIVDGNGQQVVLRGAAIGGWMNMENFITGYPGHEFQHRASMRKVLGEEK
AEYFFDKWLEYHFTEADARFFASLKLNCIRLPFNYRHLEDDMNPRVLKESGFKHLDRVID
ICAKHQIYTILDMHTVPGGQNPDWHSDNPTNYSAFWDYKDHQDRTVWLWQEIAKRYKDNK
WVAGYNPINEPCDPEHIRLPAFYKRLEPAIRAIDPHHILWLDGNTFSMEWVGFDDVLPNC
VYALHDYSMMGFPTGDRYKGTEDQNRKLERQFLRKAEFMLKHKCPIWNGEFGPVYADPAE
EEDAEGINHDRYNMLGQQLNIYDKHKISWSIWLYKDIGVQGMMHTNRNSKWNRTIQPFLD
KKKRYRLDAWGVHHSAEAEAALNPLVEWIDKICPTAKDAYPGPWQTERHVMRAVIQTWLS
AQFSDEFANQFQGMDFKDLDELAHSFHFDECVQREGLNKILSQHAPQ

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	337	4.3e-128	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	8.72e-19	74	336	26	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.12e-11	54	192	55	192	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80303.1|GH5_22	8.31e-276	1	465	1	465
QMW26442.1|GH5_22	1.00e-274	1	465	1	465
QMW38521.1|GH5_22	1.00e-274	1	465	1	465
UCK59003.1|GH5_22	1.51e-274	1	465	12	476
QBZ65040.1|GH5_22	3.96e-247	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.23e-23	74	335	30	316	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.06e-22	74	335	30	316	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6ZB9_A	2.43e-11	23	260	3	245	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.74e-11	23	260	3	245	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3AMC_A	9.03e-11	89	355	50	306	Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.67e-187	5	465	3	469	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	8.65e-23	74	335	30	316	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	8.65e-23	74	335	30	316	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	2.18e-22	74	335	30	316	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|B0XN12|EXGA_ASPFC	7.96e-14	22	308	41	326	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_02402-t43_1-p1.