CAZyme Information: CLCR_01989-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_01989-t43_1-p1
• CAZy Family: CE9
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	LGRB01000015|CGC4	44768.40	7.5470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000015:368075-369317(+)

Full Sequence      

MGNMDSSPSRNGSPLQQIYGSRRSLRWIACLVLAALAIIYMTGSTYDPAAMGSGLGTNTS
TGSGSTSHTSSWRHSHKKQAKSLRPVELMKRPISRDLQAIPKLIHQSWSSTELPAKFERW
SATCRQQHPDWEWVLWTDEDNEELVRTHFPWLLKTYLGLPGVIYRADLVRNLYMYMFGGV
YADLDVECLRPQDQMFAEFNVSTVTHGKPKSQAANLPKSGRKAFFGRMGTDTGSSNSIPN
AWMASTPGHPFFLIVLESVMKQISEGNTDSVEGATGPGKLYDMINEYNEPEGKWVGEALD
KHVAKNPTAKQFNPRKGLKHSVEVLPFQYIYPYSWERDGEAFREICWATKNDFSAERCKQ
LLATDHWPSYTITYWSHTWTSGGHDEGNVQKLDQDQ

Enzyme Prediction     

No EC number prediction in CLCR_01989-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	119	195	3.4e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.64e-30	75	277	57	233	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.62e-15	123	198	10	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	1.45e-102	79	392	77	410
QLI72987.1|GT32	4.69e-88	80	392	50	358
UKZ71055.1|GT32	1.44e-87	75	395	72	373
ANH56535.1|GT32	5.48e-86	80	392	84	376
BCS29894.1|GT32	3.22e-72	5	379	4	380

PDB Hits     

CLCR_01989-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	3.88e-24	94	259	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.87e-21	96	261	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	6.89e-21	98	338	53	254	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.63e-20	98	277	60	213	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	9.93e-20	100	261	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999967	0.000015

TMHMM  Annotations     

Start	End
24	46