CAZyme Information: CLCR_01165-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_01165-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: Glucan endo-1,6-beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		49299.66	4.6425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000016:704021-705637(-)

Full Sequence      

MLLTRYALFSSLLISGSQAWLPGDHRQIVSREGVDLFNRSSLHEAGLLRKRYLPHDSGND
KTAIRGVNLGSLFVVEDWLSDDVFKGFGCSSKSEFDCVSSINDQDKANSDFQGHWGSWIT
KYDLTQMVSYGLNTVRIPVGYWFLESIVDKSEHFPQGGEHYLDQVIGWAKDAGLYVIIVL
HGAPGAQATDAFTGQLNPNPGFYSTYNYDRAYQWLEWITNKVHTNPAYSTVGTLELVNEP
ERNSDTAKYPNAKANTDSLRQMFYPTAWSKIRATESSLHVPSDSQLSIMMMDQKWGSGDP
KEYLPDLNLAAYDDHQYVKYAGVAEDKDAYIRFSCSDDRSGNWPVFVGEWSLSVATDVEW
TDDWNPNRDENKDFYRNWWAAQVMSYERTAQGWIFWTWKTSGTLNDPRWDYKMEVAAGII
PTDIDSAYSMGACS

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	104	412	3.5e-126	0.9933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.49e-23	64	411	18	372	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.63e-07	114	398	15	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60381.1|GH5_15	3.05e-148	17	433	14	410
BCS30770.1|GH5_15	2.32e-147	19	433	2	398
EAA59985.1|GH5_15|3.2.1.75	4.80e-147	8	433	7	409
ABF50867.1|GH5_15|3.2.1.75	4.80e-147	8	433	7	409
BCS24206.1|GH5_15	4.16e-143	19	433	16	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.70e-33	60	433	5	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	5.11e-33	60	433	10	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.70e-32	60	433	5	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.87e-32	60	433	11	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	4.89e-32	60	433	11	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	8.52e-148	8	433	7	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	6.71e-145	2	433	1	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	5.74e-137	19	434	20	404	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	5.76e-135	2	412	1	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	6.60e-134	2	412	1	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000779	0.999190	CS pos: 19-20. Pr: 0.9595

TMHMM  Annotations     

There is no transmembrane helices in CLCR_01165-t43_1-p1.